KEGG   Salmo salar (Atlantic salmon): 106589612Help
Entry
106589612         CDS       T04363                                 

Definition
(RefSeq) fatty acid synthase-like
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00061  Fatty acid biosynthesis
sasa01100  Metabolic pathways
sasa01212  Fatty acid metabolism
sasa04910  Insulin signaling pathway
Module
sasa_M00082  Fatty acid biosynthesis, initiation
sasa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106589612
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106589612
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sasa01004]
    106589612
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106589612
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     106589612
Lipid biosynthesis proteins [BR:sasa01004]
 Fatty acid synthase
  Animal type
   106589612
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106589612
  Exosomal proteins of breast milk
   106589612
  Exosomal proteins of colorectal cancer cells
   106589612
  Exosomal proteins of bladder cancer cells
   106589612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt Thioesterase KR Ketoacyl-synt_C KAsynt_C_assoc PS-DH ADH_zinc_N_2 ADH_zinc_N PP-binding adh_short Thiolase_N adh_short_C2 ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 106589612
NCBI-ProteinID: XP_014035275
UniProt: A0A1S3Q5U3
LinkDB All DBs
Position
ssa28
AA seq 2526 aa AA seqDB search
MEEIVVAGISGRLPESNNLEEFWENLFNGVDMVTEDDRRWKPGLYGLPKRNGKLKDISRF
DAAFFGVHPKQAHTMDPQLRLMLEIGYEAIVDGGLNPTELRGSRTGVYIGVSGSEAGEAF
SRDPEELLGYSMTGCQRAMFANRLSYFFDFNGPSTAIDTACSSSLLALENAFNAIRHGHC
DAALVGGVNLLLKPNTSVQFMKLGMLSPEGTCKSFDSSGNGYCRSEAAVAVLLTRRSMAK
RVYATILNAGNNTDGYKEQGVTFPSGEMQQRLVRSLYQEVNITPDQVEYIEAHGTGTKVG
DPQEVNGIVSVFCHSKRDPLLIGSTKSNMGHPEPASGLAALAKVVLSLERGVWAPNIHYN
SPNTDIPALSDGRLRVVNEPIPVRGGIVGINSFGFGGSNVHVILRPPGFNTPKSFKVPPK
TPSVSSQVPRLLQACGRTEEAVSALLSKGKEHSGDDNFLCLLNEVSGVPTAGMPYRGYTL
IGSKDDVTEVQKTEATPRPLWYICSGMGTQWGGMGRSLMQLPEFRESILRSDVALKDTGM
CVSSLLMEADESTFEDTVQAFVGLAAIQIAQIDLLQKLGLQPDGIVGHSVGELACGYADG
SLSHSEAILAAYWRGRSIKEANLPPGGMAAVGLTWAECKAQCPQGVVPACHNAEDTVTIS
GPAEAVSKFVAELKESGVFAKEVRSAGVAFHSYYMASIAPALLAALKKVIKEPKQRSARW
ISTSIPQKDWDSSLALYSSADYHCNNLVSPVLFQEGLSLVPDNAVVVEIAPHALLQAILK
RSLKPTCSILPLMRRGHANNLEFFLSHIGKVYMNGINVDSKQLYPPVEYPVPVGTPLISP
LVQWDHSQTWDVPKAEDFPAGSGGSTSATIYNIDMNPESPDYYMIGHCIDGRVLYPATGY
LVLAWRTLTRSLGIVMETTPVTFEDVTIHRATILPKTGSVQLEVRLMRATSRFEVSENGN
LAVSGKVSILEDAALDSFHSEIGKPVTGDNGDPKLRLTAHDIYKELRLRGYDYGKTFQGI
LESNNAGDSGKLQWTGNWVTFLDTMLQMIVVGLSGRSLRLPTRIRSVCVDPTVHQERVTE
YGEGNKAVVVHVNRCLDNIVAGGVQICGLHATVAPRRQQQQSPPTLEEFLFVPYLETECL
SANEKLGDQLKNCKGLIHKLQKKLAPQGVKLSIPGLEGVSDPAVPSPESAEPGLLRLLSL
LCGLELNGNLRSELEQTVEKERDCLLQDPLLHGLLDGPALRHCLDTALENTTPGKIKVLE
ALSNDGHLFSRAVPLLNIQPMLRLDYVATATTLDLLTPHQTTLDAMGVTSAQWDPQQGPV
PGGAVGGADLVVCNHAWGPLGAGAEVVVGNLASGAKEGGFVMLHTLLKGETLGEMVAFLT
SKDSQNNQQRLLSQTEWEKAFSDASLNLVAVRKSFYGSALFLCRRRLPSKLPIFLPVDSM
DYQWVDTLKATLAEPSDSPVWLTATQGHSGVVGMVNCLRQEPGGSRIRCAFVSNLCESSA
APTLQPAHNSMRSVLEGDLCMNVFRDGHWGVFRHQLISQDLSEELTEQAYVNVLTRGDLS
SLRWIASPLRHFVASSPHVQLCRVYYSSLNFRDIMLATGKLPPDAIPGDLALQQCMLGME
FSGRDPSGRRVMGLLPAKGLATCVDADTRFLWDIPDGWTLEQAASVPVVYATAYYSLVVR
GRLRPGESVLIHSGSGGVGQAAIAIALSQRCRVFTTVGSAEKRAYLQERFPQLTSESFAN
SRDATFEQHVLLNTQGKGVDMVLNSLAEEKLQASLRCLARHGRFLEIGKYDLSNNSPLGM
ALFLKNVAFHGILLDALFEEGNREWEEVSQLLKRGIEGGVVKPLRTTVFERDQVEEAFRY
MAQGKHIGKVLLQVRSEEKGGGTQAVGSPLSLPAICRTFCPASHSYIITGGLGGFGLELA
HWLTERGARKLVLTSRSGIRNGYQAKRVREWQGMGVQVLVSTSDVSTLEGAERLINEACR
LGPVGGVFHLAMVLKDGMLENLTPQLFLDVNKPKYNGTLHLDRVTRKLCPDLCYFVAFSS
VSCGRGNAGQSNYGYANSAMERVCEQRRHDGLPGLAVQWGAIGDVGVVLETMGGNDVVVG
GTLPQRITSCLEVLDRFLCERRPVMSSFVLAERSVVKSNGTGQRDLVEAVAHILGVRDVS
SLNADASLADLGLDSLMGVEVRQTLERDYDIVMAMREIRQLTINKLRELSRQPVGTTESC
QSPVKKGGVHSLLESDLSLMLVNPDGPTVSRLNEVQSAERPLFLVHPIEGSIAAFHTLTA
KLSVPCYGLQCTKAAPLDSIQSLATYYVECIRQVQSEGPYRIAGYSFGACVAFEMCSQLQ
AQGRTVDYLFLFDGSHSYVAAYTQSYKSKLTPGKESEAETEALCAFIQQFTGIEYNKLLE
TLLPLSDLKARVNMAVDLIPSSHKNVSKDSLRFAAATFYYKLKAADGYVPATKYHGNVTL
LRAKASSDYGDNLGADYKLSEVCDGKVSVHVIEGDHRSFLEGEGVESISSIIHSSLAEPR
VSAREG
NT seq 7581 nt NT seq  +upstreamnt  +downstreamnt
atggaggagattgttgtagccgggatatcgggccggcttcctgagtctaacaacctcgag
gaattctgggagaacctcttcaatggggttgacatggtaacagaagatgaccgaaggtgg
aagccaggtctgtacggtcttccaaagaggaacggcaagctgaaggacatcagccggttc
gatgcagcgttcttcggggtccaccccaaacaggcccacaccatggacccccagctacgc
ctcatgctggagatcggctacgaagccattgtcgacggaggtctgaatccgacggagctg
cgtggcagcaggacaggcgtctacatcggcgtgagcggctcggaggcgggcgaggccttc
agcagagaccctgaggagttgctaggatacagcatgacgggctgccagcgtgccatgttc
gcaaaccgactctcctatttctttgacttcaacggccccagcacagccatcgacaccgcc
tgctcctccagcctactggctctggagaatgccttcaacgccattcgccacggccactgt
gatgccgccctggtgggcggggtcaacctgctgctcaagccaaacacctctgtgcagttc
atgaagctgggcatgctcagtccggaaggaacctgcaagtcctttgactcctcaggaaac
gggtactgccgttcggaggctgcggtggcggtactgttgaccagacgttccatggctaag
agggtatacgccacgatactcaacgctggtaacaacactgacggatacaaggagcagggt
gtgacgttcccctcaggtgagatgcagcagcggctggtacgttctctctaccaggaggtc
aacatcacacctgaccaggtggagtacatcgaggcccacggcaccgggaccaaggtcggt
gacccgcaggaagtgaatggcattgtcagtgtgttctgtcattcaaagcgtgacccactg
ctcattggctccaccaagtccaacatgggccatccagagcctgcctctggcctggctgcg
ctggccaaggttgtgttgtctctggagcgaggtgtgtgggctcccaacatccactataac
agccccaacaccgacatacctgcccttagtgacggccgcctccgcgtcgtcaacgagccc
ataccagtccgcggcggcatcgttggcatcaactctttcggatttggcggctctaacgtt
cacgtgatcctccgcccccctggtttcaacacaccaaaaagctttaaagtgccccccaag
accccctctgtgtcctctcaagtacccaggctcctccaggcctgcggccgcacagaggag
gctgtctccgccctcctcagcaaggggaaggaacactcgggcgacgacaacttcctgtgt
ctgctgaacgaggtgtccggggtacccacggccgggatgccctacaggggctacactctg
attggctccaaggatgatgtcacagaggtgcagaagactgaggccacgcccagaccgttg
tggtacatctgctcaggtatgggcacccaatggggtgggatgggccgcagtctgatgcag
ctgccagagttcagggagtccatcttgcgttcggacgtagcattgaaggacacggggatg
tgtgtgtccagtctgctcatggaggcagacgagagcaccttcgaggacaccgtccaagcc
ttcgtaggccttgccgccatacagatcgcccagattgacctgctccagaagctgggtctg
cagccggacggcattgtgggccacagtgtgggagagctggcctgtggctacgcagacgga
tccctcagtcacagtgaggctatcctggcagcctactggagagggaggtccatcaaggag
gctaacctgccccccgggggcatggctgcagtcggactgacatgggcagagtgtaaggct
cagtgtcctcagggtgtggttccagcctgtcacaatgctgaagacaccgtcaccatctct
ggccctgcggaggcagtgagtaagtttgtagcagagctgaaggagagtggtgtgtttgcc
aaggaggttcgtagtgctggtgtagccttccattcttactacatggcttccattgctccc
gccctgctggctgctctcaagaaggtgatcaaggagccgaagcagaggtctgccaggtgg
atcagcacatctatcccccagaaggactgggacagctcgctggctctgtactcctcagca
gattaccattgtaataacctggtcagccctgtcctcttccaggagggcctcagcctggtg
cctgataatgctgtggtggtggagatagcaccacacgctctgctgcaggcgatcctgaag
cgtagcctgaagcccacgtgttccatcctgcccctgatgaggagaggccacgccaacaac
ctggagttcttcctctctcacatcggcaaggtctacatgaacgggatcaacgtggacagt
aagcagctgtacccgcccgtggagtacccggtgcccgtgggcaccccgctgatctccccc
ctggtgcagtgggaccactcccagacctgggacgtacccaaggctgaggacttccctgct
ggttctggagggtccacctcagctaccatctataacattgacatgaacccagagtctcca
gactactatatgattggccactgcatcgacgggcgtgtcctgtacccggcgacgggttat
ctggtactggcctggaggaccctgacgaggagcctcggcattgtcatggaaaccacccct
gtcaccttcgaggacgtcaccatccacagggccaccatcttacccaagaccgggtcagtc
cagttggaggtgcgtctcatgcgtgccaccagtcggtttgaggtctctgagaacggcaac
ctggctgtcagtggcaaggtgagcattctggaggacgctgctctggactcattccactct
gagattggtaagcctgtcaccggggacaatggtgaccccaaactgcgcctgacagcccac
gacatctacaaggagctccgtctccgtggttatgactacggcaagacattccagggcatc
ctggagtccaacaatgcaggtgacagtgggaagctgcagtggacgggtaactgggtgacc
ttcctggacaccatgctgcagatgatcgtggttggcctatcaggacgcagccttcgcctg
ccaacgcggatccgctctgtgtgtgtcgaccccaccgtccaccaggagagggtcactgaa
tacggagagggtaacaaagccgtggtcgtccacgtcaaccgttgccttgacaacatcgtt
gcgggcggagtgcagatctgtggtctccacgccacggtggcaccgcgtcgccaacagcaa
cagagcccgcccaccctggaggagtttttgtttgtgccctacctagagacagaatgcctg
tcagccaatgagaagctgggagaccagctcaagaactgcaaaggtctgatccacaagctg
cagaagaagctggctcctcagggcgttaagctctccatccctggtctagagggggtgtct
gatcctgctgtccccagccctgagtccgctgagcctggcttgctgcggctgctgtccctg
ctttgtggtctagagctgaacgggaacctgcggtcagagctggagcagactgttgagaag
gagagggattgtctcctccaggaccccctgctacatggcctactggatggcccagccctc
agacactgtttggacacagccctggagaacactacccccgggaagatcaaagtcctggag
gccctctccaacgacggccatctcttctcccgagccgtgcccctccttaacatccagccc
atgctccgcctcgactacgtcgccactgccactaccctcgacctcctgaccccccaccag
accaccctggatgccatgggggtcacctcagcccagtgggacccccagcagggccctgtg
cccgggggtgcggttggtggggccgacctggtggtgtgtaaccacgcctggggtcccctg
ggggccggggctgaggtggtggtggggaacctggcctcgggggccaaggaggggggcttt
gtgatgctccacaccctgctgaagggagagacgctgggggagatggtggcattcctcacc
tccaaggacagccagaacaaccagcagagactgctctcccagactgagtgggagaaagcc
ttctctgatgcgtctctcaacttggtggctgtcaggaagtcattttatggctctgcctta
ttcctgtgtcgccgtcggttacccagcaaactgcccatcttcctgcctgtggacagcatg
gactaccagtgggtggacacactcaaggcgacgttggctgagccctcagactctccggtc
tggctgactgctacccagggccactctggggtggtgggcatggtcaactgtctacgccag
gagcccgggggcagccgcatacggtgtgcatttgtgtccaacctgtgtgagtcttctgcg
gcgcccaccctgcagcctgcccataattccatgcggtctgtgctggagggagacctgtgt
atgaacgtgttcagggatggacactggggagtgttcagacaccagctcatctctcaggat
ctgagtgaggagttgaccgagcaggcttacgttaacgtgttgacccgtggtgacctctcc
tcgctgcgttggatcgcctcgcccctccgccattttgtggcgagcagcccccatgtgcag
ctgtgtcgcgtctactacagctccctcaacttcagagacatcatgctggccaccgggaaa
ctgccaccggacgccatcccaggcgacctggccctacagcagtgcatgttgggtatggag
ttctcgggtcgtgaccccagcggtcggcgtgtgatggggctgctgcctgctaaaggcctg
gccacctgtgttgacgctgacacgcgcttcctctgggacatcccagatggctggaccctg
gagcaggcagcgtcggtgccggtggtctatgccacagcctactattccctggtggtccga
ggcaggctccgcccaggggagagtgttctcatccactcagggtcagggggcgtcggccag
gctgccatcgccattgcactcagccagcgctgtagggtcttcactacggttggttcagca
gagaagcgtgcctacctacaggagcgtttcccccagctcacctctgagtcctttgccaac
tctagagacgccaccttcgaacagcacgtcctgctaaacacacagggaaaaggagtggat
atggtgttgaactccctggctgaggagaagcttcaggccagtcttcgctgtctggctcga
cacggacgcttcctggagatcggcaaatacgacctgtccaacaactcccctctgggtatg
gctctcttcctgaagaacgtggcgttccacgggatcctattggacgccctgtttgaggag
gggaacagggagtgggaggaggtgtcccagctgctgaagcggggcattgagggaggtgta
gtcaagccactgaggactacggtgtttgagagagaccaggtggaggaggctttcagatac
atggcccagggaaaacacatcggcaaagtcctgctgcaggtgcgttcagaggagaagggt
ggtggtactcaggcggtgggctcgcccctctccctccccgccatctgccgtaccttctgc
cctgcttcccactcttacatcatcaccgggggactgggcggcttcggcttggagctcgct
cattggctgacggagagaggcgcccgcaaactggtgctcacctccagatcgggcatccgc
aacggttaccaggcgaagcgcgtgcgtgagtggcaggggatgggtgtacaggtgctggtg
tccaccagtgatgtcagcaccctggagggggcggagcgactcatcaacgaggcctgcagg
ctggggcctgtgggaggagtcttccacctcgccatggtgttgaaggatggcatgctggag
aatctgactcctcagctgttcctggatgtcaacaaacccaaatacaacggaaccctccac
ctggacagggtgaccaggaagctgtgtccagacctctgctactttgtagccttctcctct
gtgagctgcggccgcggcaacgccggccagagtaactacggttacgccaattccgccatg
gagcgcgtgtgcgagcagcgacgccacgatggcctgcccggattggccgtccagtggggc
gccatcggcgacgtgggcgttgtcctggagaccatgggcggtaacgacgtggtggtgggc
gggactctcccgcagcgcatcacttcctgtctggaggtgctggaccgcttcctgtgcgag
cggcgtccggtgatgtcgagcttcgtgctggcagagaggagcgtggtgaagagcaatgga
acaggacagagagacctggtggaggctgtcgctcatatactgggtgtgcgtgacgtcagc
agcctaaacgctgacgcctcattggctgatctgggtctggactctctgatgggcgtggag
gtgcgtcagacactggagcgcgattatgacatcgtcatggcaatgagggagatccgacag
ctcaccatcaacaagctccgagagctgtccaggcaaccggtgggaacaacagagtcctgt
cagtctccagtgaagaagggaggagtgcattctctgttggagtcggacctcagtttgatg
ctggtcaacccagacggtcccacggtctcacgtctcaatgaggtgcagagtgctgagcgc
ccgctgttcctggtccaccctatagagggctccatcgctgccttccacacactcaccgcc
aagctcagtgtgccctgctacggcctgcagtgcactaaagctgctcctttggacagtata
cagtctctggctacatactatgtggagtgtatacgtcaggtgcaatcggagggtccgtac
cggattgccggctactcctttggggcctgcgtggcgtttgagatgtgttctcagctgcag
gcccagggtagaactgtagattacctcttcctctttgacggatcacactcctacgtcgcc
gcttacacacagagctacaaatccaagctgacccctggtaaagagtctgaggcagagact
gaagcactgtgtgctttcatccagcagttcactggcatagagtacaacaagttgttggag
accctgctccctctgtctgatctgaaggcccgtgtcaacatggcggtggacctcatcccc
tccagccataagaacgtcagtaaagactccctgcgattcgccgccgccaccttctactac
aaactcaaggctgccgacggttatgtaccggcaaccaaataccacggcaacgtcactctg
ctccgcgccaaggccagcagcgactacggagacaacctgggggctgactacaaactgagc
gaggtgtgtgatggtaaggtgtcggtccacgtcatcgagggagaccaccgcagcttccta
gaaggagagggggtggagtctattagtagcatcatccatagctcattggccgagccacgc
gtcagtgcccgggagggttag

DBGET integrated database retrieval system