KEGG   Salmo salar (Atlantic salmon): 106590733
Entry
106590733         CDS       T04363                                 

Gene name
ikbkg
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04210  Apoptosis
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04623  Cytosolic DNA-sensing pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106590733 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106590733 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106590733 (ikbkg)
   04621 NOD-like receptor signaling pathway
    106590733 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    106590733 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    106590733 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    106590733 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106590733 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106590733 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106590733 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106590733 (ikbkg)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   106590733 (ikbkg)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 DUF4407 DUF1283 DUF4246
Other DBs
NCBI-GeneID: 106590733
NCBI-ProteinID: XP_014037367
UniProt: A0A1S3QBY8
LinkDB
Position
Un
AA seq 230 aa
MEQQRKQHSVTVDKLLLQTHNLETALKTDRLVITEEKRKLAQLQHAYTCLFKDYDCKLKT
EGGDMVVRLEEAERALALKQDLIDKLKEEVEQHRGSLETVPVLTAQAEIYKADFLAEREA
REKLNQRKEELQDQLNRALAEMERLKQEEASRARMEKMQQRHLEVFRPPRPHITPQPGNT
FNTSSRSVGLSAEGVAGGGAEELPDYRCPKCQYQAPDMDTLQIHVMDCIQ
NT seq 693 nt   +upstreamnt  +downstreamnt
atggaacaacagaggaagcagcactctgtgaccgtagacaaactacttctgcagacacac
aacctagagaccgccctgaagactgaccgcctggttatcactgaagagaagaggaagcta
gcccagctgcagcacgcctacacctgtctctttaaggactacgactgcaaactaaagact
gagggaggagacatggttgttcgtctggaggaagcagagagagcgttggctctgaaacag
gacctgattgacaagctgaaggaagaggtggagcaacacagaggatctctagaaaccgtc
cctgttctcaccgcccaggctgagatctacaaggcggacttcctagcggagcgggaggcc
agagagaagttgaaccagaggaaggaggagcttcaggaccagctgaacagagcgctggca
gagatggagcgtctgaaacaggaggaggcgtcacgggctcggatggagaagatgcagcag
agacacctggaggtcttcagaccaccacgaccccacatcaccccacaaccagggaatacc
tttaacacttcctcgcgcagcgtgggattgtctgcagagggagtggccggaggcggggct
gaagagcttcctgactaccgctgtccaaagtgccagtaccaagcccccgacatggacacc
ctgcagatacatgtcatggactgtatccagtaa

DBGET integrated database retrieval system