KEGG   Salmo salar (Atlantic salmon): 106591441
Entry
106591441         CDS       T04363                                 

Gene name
atr
Definition
(RefSeq) ATR serine/threonine kinase
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa03460  Fanconi anemia pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    106591441 (atr)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106591441 (atr)
   04115 p53 signaling pathway
    106591441 (atr)
   04218 Cellular senescence
    106591441 (atr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106591441 (atr)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sasa03400]
    106591441 (atr)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106591441 (atr)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   106591441 (atr)
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    106591441 (atr)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME HEAT DUF4080 V-ATPase_H_C
Other DBs
NCBI-GeneID: 106591441
NCBI-ProteinID: XP_014038131
UniProt: A0A1S3QDV2
LinkDB
Position
Un
AA seq 2565 aa
MEGLEMSAMIPALQELASATAEEYNKVVQKPRQILCQFIDRILTDVDVVALELSKRSSSE
PACVMLLDFVQHIIKSSSLMFVNPACQLAHFTDTQQSSTEFSRWVVGRLLRVAASPSCDV
IHGRVSAVLCSLLHALRPRAPITFNVIAKEMLGLAQDLSNLLYTHTHSHTPGTHKHSTNT
HTLWPVTLQSFSVSLTPYLTPSPLLLPSPAALETLVAVTVNVLTDALRGLASRREMGVAW
EAGCLVVAYGSARLRKVAMVMLRRLAEIGGFPERRSQEFFTAYLTLLDTHTPEPETYGGE
LLKLTQCVFGSAHTPAHTHTRFERTHLAQLLERVCVLAGAGLVLESEVSQSLSFVFNFLL
SVPPGYESAPSLRKQRVTDVCRTLTHSIGMEKQSECVQGFLYTALKAEVAVVMQEREDGE
TAAKRPCLPITPLASKTPKTSPMEVDMRVRSEVWAAVTSRLDDLLASLVNCDLDLTTPEP
DTDPQMTLRALEGLALILHLAGLCYTHTRYLTHTQKVTHPTSSLTQIFPSLSLSSSSSSL
LWLSASTLGRALETCQSLLGGAKSTTDHAHIQSAIQVAVRILDSIIYLTMSSPAEDSGLQ
SSVCTLLSVPWVCELSSVPAYQKAGFPPSLPDLAKRLSPCYSPQVQAECVLLLSLLRGDV
CVSWRVSVCSQALESHHEVVRASAVRSFPLLLHHVGHTHHNLTHTTLMSVLEDSSEQVRA
ELAGISGQLTCVLSGSSKLTVNHKEPLPLPMILCSRLGLAAEHAGKGTPIGASVIKPVLP
LLRPSSSSVAKRAFLDALPHLCQHVNLGGRDSDSLAILRDLIGLIEDPDPSVRTLFSQSV
RFLLSEPTSEPDQDPVKELLVSRVKEAFSKAKLNRDDELRSTLILTTGEIGRAAKGSLVS
FSLLRLLHCLLSKSSPVSVSAYTQITALATARGLKLQTLFSQYKNPVCQFLVESLHSRHV
SALRSTPEQGSQLTNQREVALDILSQVAHAFDFPDLHRFLTRTLQVLLPYLAAKASTTGS
ALIRTLANEMKANRREILINNFKYIFSHLVCSCTKEELERAFHYLQRETEIELGSLLRQD
FQGLHNELLLRLGEHYQQVFNGLAILASFASNDDPYQGPRDITTPEHMADYLQPKLLGIL
AFFNMQLLSSSAGEKDGKKMALTSLMALMKLMGSKHTSSVRVKMMTTLRTGLRYRQDFPL
LCCQTWDCFVRTVEPAHLGPLLSHVIVALLPLIPLQPRETAAIIHYLILDNREEVQDYLH
EIYFLPDHPELKDIHTVLQDYKKLTSRTSDLAAGLQLSMRAVQHENLDVRVHALTSLKDM
MHSNQEWLLRQVCASEAVEPVISSLVSVLLRGCQDSSPTARLLCGECLGELGAVDPGRLD
LSHTQTHGSSNTFVSGVEESNFAYELLTELTRTFLAYADDVRAQDSAAYAMQELLSIFEC
REGRSDSPGRRLWRRFPEQVQEILEPHLNSRYKSSQKVVNWSKVKKPVYLSSRGTKFSDW
SATWAGYLISKVRHELASKVFTCCSFIIKHDYKVTIYLLPHILLYMLMGCTAVEQGEVTE
EMLAVLTEGDGRGGRVQEASSSLSQLSTQNQEATSSLSQLSTQTVFSMLAHLTQWSRHTL
SARIKHSESGDYQRVVAFLKGIPQDVLAKASLRSKAYTRALMHFEAYILENKENIQDHLS
FLQTLYAAMHEPDGVRGANALRREEPSLREQILEHESIGLLRDATACYDRAIQLESDQIG
HYHGVMSSMLGLGQLSTVVTQVNGVLANRPQWKSDLNTYRVEAAWKLSKWDLLEDYLGSD
RKSSTWGVRLGQMLLAAKRRDAETFYDKLKLVRTEQVVPLAAASYETGTYQRGYEYIVRL
HMLSELEHAFTDLQRQREGHAPSSATLPSHWPDRLEMTQNSFRAKEPILALRRALLSIGS
GVCEGLVGECWLQSARVARKAGHHQTAFNALLNGQNTHTAELLTEKAKWLWSKGDVHQAL
IVLQKGVTQCFPVDQPLSDQRSLQTKGKAMLLVGRFMEETANFESNAIMKAYRDVTTLLP
EWEDGNFYLAKYYDKLMPMVTDNKLEKQGNLIRYIVTYFGKALQFGNQYIYQAMPRMLSL
WLDFGAKVYESEKAGRVERQLRVELGKINQVVSDHCTSLAPYQFLTAFSQLISRVCHSSE
DVFNVLMDIAAKVLLAYPQQAMWLMTAVSKSSYPTRMNRCKEILRKAVSLKESLGKFIGD
ANRLTDKLLELCNKPVDGSSSTLSMGVHFKQLKRLVEEPSFSQILIPLQSVLIPTLPSTG
PANTLHHDAFPGHWAYLDGFDDTVEILASLQKPKKIGLKGSDGRSYTVMCKPKDDLRKDC
RLMEYNCLINKCLRKDAESRRRELHIRTYAVIPLNEECGIIEWVNNTGGLRHILTKLYKE
RGILMSGKELKKFILPKTASFEEKLKVHKDLLCARHPPVFYEWFLRTFPDPTTWYSSRSA
YCRSTAVMSVVGYILGLGDRHGENILFDSFTGECVHVDFNCLFNKGETFDVPEVVPFRLT
QNMVHAMGPMGTEGLFRTACEVTLRLMRDQREPLMRASSDQHVPN
NT seq 7698 nt   +upstreamnt  +downstreamnt
atggaaggcttggaaatgtccgctatgatacctgcactgcaggagctagcgagtgccacc
gcagaggaatacaacaaggtggttcagaagcctcgtcagattctctgtcagttcattgac
cgaatactgacagacgtagatgtcgttgcgttggagctgtctaagaggtccagttcagag
ccagcgtgtgtgatgctgttggactttgttcagcacattataaagtcttcctctctgatg
tttgtcaaccctgcctgtcagctggcccacttcacagacacacagcagagcagcaccgag
ttcagtaggtgggttgtcggcaggttgctgcgagtcgccgcatcgccaagctgtgacgtc
atccatgggcgtgtctcggccgtgctctgctccctactgcacgcactcagaccgcgagca
ccaatcaccttcaacgtcatcgccaaagagatgcttggattggcccaggacctcagcaat
ctgctctacacacacacacactcacacaccccaggaacacataaacactctacaaacaca
cacaccttgtggccggtaaccctgcagtctttctctgtctctctcaccccttatctcacc
ccctcacccctcctcctcccctcgcctgccgccttggaaaccctggttgcggtgacagtg
aacgttctaactgacgccctcaggggattggccagccgcagggagatgggggtggcttgg
gaggcaggctgtttggtcgtggcctatgggagtgctcggttaaggaaggttgctatggtg
atgctgaggcggttggcggagattggtgggttcccggagaggcggagtcaggagtttttt
acagcgtacctgacgctgctggacacacacacacctgagccagagacatatgggggagag
ctgctgaagctgacgcagtgtgtgtttggatctgcgcacacacctgctcacacacacaca
cggtttgagcgtacccacctggcccagctgttggaacgtgtgtgtgttctggcaggggcg
ggcttagttctggaatcagaggtcagccaatcgctgagctttgtctttaacttcctgttg
tccgttccaccgggatatgagagcgccccgtctctacggaaacagagagtcactgatgtc
tgcagaaccctcacacactccatcgggatggagaaacagtctgagtgtgtgcaggggttt
ctttacactgccctgaaggctgaggttgccgtggtgatgcaagagagggaggatggagaa
acggctgctaagcgaccctgtctacccatcacccccctggccagcaagacccccaaaact
tccccgatggaggtggacatgcgtgtgcgtagtgaggtgtgggcggcagtgaccagcagg
ctggatgaccttctggcctctctggtgaactgtgaccttgacctgacgacccctgagcct
gacactgaccctcagatgaccctgagagctctggagggactcgctctcatcctgcacctg
gctggcctctgttacacacacaccaggtatctcacacacacccagaaggtaacacacccc
acatcatctctcacacagatctttccatctctgtctctctcctccagctcctcctctctc
ctgtggctgtctgcctccactctgggcagggctttggaaacctgtcaatcactactgggc
ggggctaagtctaccactgaccacgcccatatacagtctgccatccaggtggctgtcaga
atactggactccatcatctacctgacaatgagtagcccggctgaggacagtggtctccag
agtagtgtgtgcacgttgctgtctgtgccatgggtgtgtgagctgtcgtctgtcccagcc
tatcagaaggcaggattcccccccagcctccccgacttggctaagagactgtctccctgc
tactccccccaggtccaggcggagtgtgtgttgctgctgtctctgctgcgtggggatgtg
tgtgtgtcgtggcgtgtgtctgtgtgttcccaggccctggagagtcaccatgaggtggtc
agggccagcgctgtcaggagctttcctctactactgcaccacgtgggacacacacaccac
aacctcacacacaccaccttaatgagtgtcctggaggacagctcagagcaggtgagggca
gagctagctggtatttctggtcagctgacctgcgtcctgtcggggagctccaaattaact
gtcaatcacaaggaacccctcccactacccatgatcctttgctcccgcctcggccttgca
gctgagcatgctgggaagggcactcccattggagcatccgtcatcaagcccgtcctacct
ctgctacgaccgagcagcagcagtgttgccaaaagagcgttcctagatgctctgccgcac
ctctgccagcatgtcaaccttggaggcagagacagtgactctctggccattctgagagat
ctgattggcctaatagaagacccagacccgtcagtcagaacactcttcagccaatcagtt
cgcttcctgctgtcggagcccacctccgaacccgaccaggatccagtcaaggagctgctg
gtgtctcgtgtgaaggaggcgttcagtaaggctaaactcaacagagacgacgagctacgc
agcacactcatactgaccactggagagattggcagggctgctaaaggtagcttggtgtcg
ttctctctcttgaggttactgcactgtctcctgtccaagtcgtctcctgtctctgtgtcc
gcctacacacagatcactgccctggccacagctagaggactcaaactacagacactgttc
agccagtacaagaaccctgtctgccagttcctggtagagtctctccactcgcgtcacgtc
agcgccctgcggagcacgccagagcaaggtagccagctaaccaatcagagagaagtagct
ctggacatcctgtctcaggtcgcccacgcctttgacttccctgacctgcaccgcttcctc
acgaggactctccaggtgctcctcccctacctggctgcgaaggccagcaccacaggctcc
gccctcatcaggacgctggccaatgagatgaaagcgaaccggcgtgagatcctgatcaac
aactttaagtacatcttcagccacctggtgtgttcctgcactaaggaggagctggagaga
gccttccactacctccagagagagacggagatagaactgggctctctgctgaggcaggac
ttccagggcctgcacaacgagctgctgctacgcctgggagaacactaccaacaagtgttt
aatggtctggccatcctggcctcatttgcctccaatgacgacccgtaccagggaccccgt
gacatcaccaccccggaacacatggctgattacctccagcccaagctgctgggcatcctg
gccttcttcaacatgcagctgctgagctccagtgctggggagaaggacggtaagaagatg
gccctgaccagcctgatggccctgatgaagctgatgggctccaaacacaccagctcagtc
cgagtcaagatgatgaccacactacggactggactacgatacagacaggacttccctctg
ctctgctgccagacgtgggactgttttgtgcgtacggtagagcccgcccacctggggccg
ttgctcagtcatgtgatcgtggcgcttcttccgctgataccactccagcccagagagact
gctgctataatacattacctcatactggacaacagggaagaggtgcaggactatctccat
gaaatctacttcctgccagaccaccctgaactcaaagacatacacactgtcctgcaggac
tacaagaagttgacgtccaggaccagcgacctggctgcaggcctgcagctctccatgagg
gctgtccaacacgagaacctggacgtcagagttcacgctctgaccagcctcaaggacatg
atgcacagcaaccaggagtggttactacgacaggtgtgtgcgtcggaggcggtagagcct
gtcatctcctcattagtctcagtgttactgcgaggttgtcaggactcttccccaacggcc
aggctgctgtgtggggagtgtctgggggagctgggggccgtggaccctggacggctggac
ctctctcacacacagacacacggcagcagcaacaccttcgtgagtggggtggaggagagt
aactttgcctatgaactactgacggagctgaccaggactttcttggcgtatgctgatgat
gtcagagcacaggactcggcagcctatgcaatgcaggagctgctgtctatatttgagtgt
cgtgagggccgtagtgactcccctggtcgacggctgtggaggagattccctgaacaagtc
caagagatactggagcctcacctcaacagcaggtataagagcagtcaaaaggtggtgaac
tggtccaaggtgaagaaacctgtctacctcagcagccgaggaaccaagttctctgattgg
tcagctacctgggccggatacctcatcagcaaggtgagacatgagttggccagcaaggta
ttcacctgttgcagtttcatcatcaaacacgactacaaagtcaccatctacctgctgccc
catatactgctttacatgctgatgggctgcactgctgtggaacaaggagaggtaacagag
gaaatgctggctgtgctcacagagggtgatgggcgtggtgggcgtgtccaggaggcctca
tctagcctttcacagctcagtactcagaaccaggaagcaacgtccagcctgtcacagctg
agcacccagactgtgttcagtatgctggctcacctcacccagtggagccgacacacactg
tcggctagaatcaaacacagcgaaagtggtgactaccagcgagtggtagcgtttctaaaa
gggatccctcaggacgtgttagccaaggcctctctacggtctaaagcctacaccagagcc
ctgatgcactttgaggcttacatactggagaacaaagagaacatccaggatcatctgagc
ttcctacagacgctgtacgcggccatgcacgaaccggacggtgtgaggggtgcgaacgct
ctccggcgggaagagccgtccctacgggaacagattctagaacacgagagcatcgggttg
ctaagagacgctacagcctgctacgaccgggccatacagctggagtccgaccagatcgga
cactaccatggggtgatgagttctatgctggggctgggacagctctctactgtcgtcaca
caggtcaatggagtcctggccaacaggccccagtggaagtctgatctgaacacctacagg
gtggaagctgcctggaagctcagcaagtgggacctgctggaggactacctgggctctgat
cgtaagtccagcacgtggggtgtgaggctgggtcagatgctgctcgcggctaagcggcgc
gacgcagagacattctacgacaaactgaagctggtcaggacagagcaggtggtgcctcta
gctgctgctagctatgagactgggacctaccagagaggatacgaatacatcgtcaggctc
cacatgctgagtgagttggagcatgccttcaccgacctccagagacagagagaaggccac
gcccctagctcagccacgctgccctcccattggccagatcggctggagatgacccagaat
tctttccgcgccaaagagccaatcctggccctgcggcgagccctgctgagcatcggctca
ggtgtgtgtgaggggctggtcggggagtgctggttgcagagtgcccgggtggccaggaag
gcaggacatcaccagacagccttcaacgctcttctgaacggacagaacacacacactgcc
gaattactgacagagaaggccaagtggctatggtccaagggagatgtccaccaggcgttg
atagttctccagaagggagtgactcagtgtttccctgtcgaccagcctctctcagaccag
aggagtctacagaccaaaggtaaagccatgcttctggtgggacgcttcatggaggagaca
gccaactttgagtccaacgccatcatgaaggcctacagggacgtgaccaccctgctacca
gagtgggaggacggtaacttctacctggctaaatactatgacaagttgatgcccatggtg
acagacaacaagctggagaaacagggaaacctcatacgatacatcgtcacctactttgga
aaagctctgcagtttgggaaccagtacatctatcaggccatgcctcggatgctgtctctc
tggctggacttcggggccaaagtctacgagtctgagaaagcgggtagagtggagcggcag
ttgcgcgtggagcttgggaagatcaatcaggtggtcagcgaccactgcaccagcctggct
ccgtaccagttcctcacagctttctcccagctcatctccagggtgtgccacagcagtgag
gacgtcttcaacgtcctcatggacatcgctgccaaggtgctgctggcctaccctcagcag
gccatgtggttgatgaccgcagtgtccaagtcgtcctaccctacccgtatgaaccgctgt
aaggagatcctgaggaaggctgtcagtctgaaggagagtctggggaagttcataggagat
gccaacagactgactgacaaactactggagctctgcaacaagccggtggatggtagcagc
agtactctcagtatgggggtccatttcaagcagttgaagcgtctggtggaggagccgtcg
ttcagccagatcctgatccctctgcagtctgtcctcatccccacactgccctctactggc
cctgcaaacacactgcaccacgacgcattccccggacactgggcctacctcgacggcttt
gacgatactgtggagatccttgcctccctccagaagcccaagaagatcggcctgaaggga
agtgatgggaggagctacactgtgatgtgtaaacctaaagatgacctccggaaagactgt
cgcctcatggagtacaactgcctcatcaacaagtgtctgcgtaaggatgcagagtccagg
aggagggagctccatatccgtacatatgctgtgatcccactgaatgaggagtgtggcatc
atcgagtgggtcaacaacactggaggtctccgacacattctgaccaaactctacaaggag
agaggtatcctgatgtcaggtaaagagttgaagaagttcattcttcctaagactgcttcg
tttgaggagaagctgaaggtccataaggacctcctgtgtgccagacacccccctgtcttc
tatgaatggttcctccgaaccttccctgaccccaccacatggtacagcagcaggtcagcc
tactgtcgctccactgcggtgatgtccgtggtgggctacatcctgggtcttggagaccgc
catggagagaacatcctgtttgactcattcaccggggagtgtgttcacgtcgacttcaac
tgcctcttcaacaagggtgagacgtttgatgttccggaagtggttccgttcagactgacc
cagaacatggtccatgctatgggccccatggggacagaggggctcttcagaactgcctgt
gaagtcacactacgcctgatgagagaccagagagaaccgctcatgagagcctcctcagat
caacatgtgccaaactag

DBGET integrated database retrieval system