KEGG   Salmo salar (Atlantic salmon): 106592436
Entry
106592436         CDS       T04363                                 

Definition
(RefSeq) kinesin-like protein KIF3A
  KO
K10394  kinesin family member 3A
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106592436
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sasa04812]
    106592436
Cytoskeleton proteins [BR:sasa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     106592436
SSDB
Motif
Pfam: Kinesin DUF812
Other DBs
NCBI-GeneID: 106592436
NCBI-ProteinID: XP_014039258
UniProt: A0A1S3QGX7
LinkDB
Position
Un
AA seq 462 aa
RLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPA
DYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELRKKLQEGEEISGSEG
SGSEEMDEGDDEGREGGEGRRKRRGSGSSISSSDSSIEAQTTEEKPKAQTKDRGKKKVSP
DKMVEMQAKIEEERKELEAKLDMEEEERNKARAELEKRENDLLKAQQEHHLLLEKLSALE
KKVIVGGVDLLAKAEEQEKLLQESNNELEERRRRAEQLRRELEEKEAERLDMEEKYSSLQ
EEAQGKTKKLKKVWTMLMAAKSEMADLQQEHHREIEGLLENIRHLSRELRLQMLIIDNFI
PQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKDKDPFEVDLSHVYLAYT
EESMRQSLMKLERPRSSKSSRPKTGRRKRSTKPEAVMESLLQ
NT seq 1389 nt   +upstreamnt  +downstreamnt
cggctgaaagaggccactaagatcaacctgtctctgtccacgctgggtaacgtcatctca
gctctggtggacgggaagagcacccacgtcccctacaggaactccaaactcacccgcctg
ctgcaagactcactggggggaaactccaagaccatgatgtgtgcgaacatcggccctgcg
gactataactacgacgagaccatcagcacgctgcgttacgccaaccgggccaagaacatc
aagaacaaagcccggatcaatgaagaccccaaggatgccctgctacggcagttccagaag
gagatcgaagagcttaggaagaaactccaagaaggggaagagatctccgggtcggagggc
agtggatcagaagagatggatgaaggagatgacgagggaagagaaggaggagagggacga
aggaagcggagaggtagtggcagcagcatcagtagctcagactcctctatagaggcacag
accactgaggagaaacccaaggctcagactaaagacagagggaagaagaaggtttctcct
gacaagatggtggagatgcaggcgaagatcgaggaggagaggaaggagctagaagccaag
ctggacatggaggaggaggagaggaacaaggccagggcagaactggagaagagagagaat
gatctgctcaaagcgcaacaggagcatcacctgctgctggagaagctgtcagccctggag
aagaaggtgatcgtaggaggggtggacctcctggccaaggctgaggagcaggagaaacta
ctgcaggagtctaacaatgagttagaggagagacgcaggagggctgagcagctccgcaga
gaactagaggagaaggaggcggagcgtctggacatggaagagaagtactccagtctgcag
gaggaggctcaggggaagaccaagaagctgaagaaagtctggaccatgctgatggctgcc
aagtcagagatggccgacctgcagcaggaacatcaccgggagatcgagggcctgctggag
aatatccgccacctcagcagagagctacgactgcagatgctcatcatagacaacttcatc
ccacaggaataccaggagatgatcgagaactacgtacactggaatgaggacattggggaa
tggcagctgaagtgtgtagcctacactggtaacaacatgaggaaacagacccccgtgccg
gacaagaaagacaaagatccgtttgaggtggacctgtctcatgtgtacttggcctacaca
gaggagagtatgagacagtcactgatgaagctggagaggcccaggtcctccaagagtagt
aggcccaagactggacgaaggaaaagatcaacgaagcccgaggctgtgatggaatccctg
ctgcagtga

KEGG   Salmo salar (Atlantic salmon): 106604220
Entry
106604220         CDS       T04363                                 

Gene name
kif3a
Definition
(RefSeq) kinesin family member 3A
  KO
K10394  kinesin family member 3A
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106604220 (kif3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sasa04812]
    106604220 (kif3a)
Cytoskeleton proteins [BR:sasa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     106604220 (kif3a)
SSDB
Motif
Pfam: Kinesin Microtub_bd PIF1 IMUP
Other DBs
NCBI-GeneID: 106604220
NCBI-ProteinID: XP_014054139
UniProt: A0A1S3RQZ5
LinkDB
Position
ssa05
AA seq 735 aa
MPSNKMDKSDKPEVMDNVKVVVRCRPLNQKERSMGHKQAVSVDENRGTITVNKLETTHEP
PKTFTFDTVFGPDSKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVP
ELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDV
GVYIKDLSGYVVNNADDMDRIMTMGHKNRSVGSTNMNEHSSRSHAIFTITIECSEKGVDG
DQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPY
RNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKD
ALLRQFQKEIEDLKKKLQEGEEISGSEGSGSEEMDEGDDEGREGGEGRRKRRGSGSSISS
SDSSIEAQTTEEKPKAQTRKKKKVSPDKMVEMQAKIEEERKELEAQLDMEEEERNKARAE
LEKREKDLLKAQQEHHLLLEKLSALEKKVIVGGVDLLAKAEEQEKLLQESNNELEERRRR
AELLRRELEEKEAERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHHRE
IEGLLENIRHLSRELRLQMLIIDNFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMR
KQTPVPDKKDKDPFEVDLSHVYLAYTEESMRQSLMKLERPRSSKSSRPKTGRRYTTTTTV
CLPAAVGKDQRSLRL
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgccgagcaacaagatggacaaatctgacaagccggaggtcatggacaacgtcaaagtg
gttgtgcgatgtcgcccgctgaaccagaaggagaggagtatgggccacaagcaggccgtc
agtgtggatgagaaccgagggaccataaccgtcaacaaattagagaccacccacgaaccc
cccaaaaccttcacatttgacaccgtgttcggaccagacagcaaacagctggacgtttac
aatctgacagcccgccccatcatagactcagtattggagggttacaatgggaccatcttt
gcgtacggacagacagggacaggaaagacgttcaccatggagggggtgagggcagtgcca
gagctcagaggaataatccccaactcctttgctcatgtgttcggccacatcgccaaagca
gagggcgacacccggttcttagttcgcgtgtcttatctggagatttataatgaagaagtg
agagacctgctggggaaggaccagatgcagaggctggaggtgaaggagaggccagatgtg
ggcgtttacatcaaggacctgtctggttatgtggtgaacaacgctgatgacatggacagg
attatgacaatggggcacaagaaccgctcggttggctccaccaacatgaatgaacacagc
tctcgctctcatgccatcttcaccatcaccatcgagtgcagtgagaagggtgtggatgga
gaccagcacgtacgcatgggaaaactccacttagtggatctggcgggttctgagcgtcag
gggaagacaggagcgactggccagcgactgaaagaggccactaagatcaacctatctctt
tccacgctgggtaacgtcatctcagccctggtggacgggaagagcacccacgtcccctac
aggaactctaaactcactcgcctgctgcaggactcactggggggaaactccaagaccatg
atgtgtgcgaacatcggccctgcggactataactacgacgagaccatcagcacgctgcgt
tacgccaaccgggccaagaacatcaagaacaaagctcgaatcaatgaagaccccaaggat
gccctgctacggcagttccagaaggagatcgaagaccttaagaagaaactccaagaaggg
gaagagatctccgggtcggagggcagtggatcagaagagatggatgaaggagatgacgag
ggaagagaaggaggagagggacgaaggaaacggagaggtagtggcagcagcatcagtagc
tcagactcctctatagaggcacagaccactgaggagaaacccaaggctcagactaggaag
aagaagaaggtttctcctgacaagatggtggagatgcaggcgaagatcgaggaggagagg
aaggagctagaagcccagctggacatggaggaggaggaaaggaacaaggccagggcagaa
ctggagaagagagagaaggatctgctcaaagcacagcaggagcatcacctgctgctggag
aagctgtcagccctagagaagaaggtgatcgttggaggagtggacctcctggccaaggct
gaggagcaggagaaactactgcaggagtctaacaatgagttagaggagagacgtaggagg
gctgagcttctccgcagagagctagaggagaaggaggcggagcgtctggacattgaggag
aagtacaccagtctgcaggaggaggctcaggggaagaccaagaagctgaagaaagtctgg
accatgctgatggctgccaagtcagagatggccgacctgcagcaggaacatcaccgggag
atcgagggcctgctggagaatatccgccacctcagcagagagctacgactgcagatgctc
atcatagacaacttcatcccacaggaataccaggagatgatcgagaactacgtacactgg
aatgaggacattggggaatggcagctgaagtgtgtagcctacactggtaacaacatgagg
aaacagacccccgtgccggacaagaaagacaaagatccgtttgaggtggacctgtctcat
gtgtacttggcctacacagaggagagtatgagacagtcactgatgaagctggagaggccc
aggtcctccaagagtagtaggcccaagactggacgaaggtacaccaccaccaccaccgtc
tgtctccccgctgctgtcggaaaagatcaacgaagcctgaggctgtga

KEGG   Salmo salar (Atlantic salmon): 106612218
Entry
106612218         CDS       T04363                                 

Definition
(RefSeq) kinesin-like protein KIF3A
  KO
K10394  kinesin family member 3A
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106612218
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sasa04812]
    106612218
Cytoskeleton proteins [BR:sasa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     106612218
SSDB
Motif
Pfam: Kinesin Microtub_bd PIF1 AAA_30
Other DBs
NCBI-GeneID: 106612218
NCBI-ProteinID: XP_014068661
UniProt: A0A1S3SWE8
LinkDB
Position
ssa09
AA seq 570 aa
MPSNKMDKSDKPEVMDNVKVVVRCRPLNQKERSMGHKQAVSVDENRGTITVNKLETTHEP
PKTFTFDTVFGPDSKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVP
ELRGIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDV
GVYIKDLSGYVVNNADDMDRIMTMGHKNRSVGSTNMNEHSSRSHAIFTITIECSEKGVDG
DQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPY
RNSKLTRLLQDSLGGNSKTMMVTNNTSCFYFLLWPSRMELSRSSHINTWHWLISSSTHGI
GSFLRQHMALAHFFVNTWHWLISSSTHGIGSFLRQHMALAHFFVNTWHWLISSSTHGIGS
VVVERLLLCCQMADLQQEHHREIEGLLENIRHLSRELRLQMLIIDSFIPQEYQEMIENYV
QWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFELDLSHVYLAYTEESMRQSLMKLE
RPRSSKSSRPKTGRRKRSAKPEAVMESLLQ
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgccgagcaacaagatggacaaatctgacaagccggaggtcatggacaacgtgaaagtg
gttgtgcgatgtcgaccgctgaaccagaaggagaggagtatgggccacaagcaggccgtc
agtgtggatgagaaccgagggaccatcaccgtcaacaaattagagaccacccacgaaccc
cccaaaaccttcacatttgacaccgtgttcggaccagacagcaaacagctggacgtttac
aatctgacagcccgccccatcatagactcagtattagagggttacaatgggaccatcttt
gcgtacggacagacagggacaggaaagacgttcaccatggagggagtgagggcagtgcca
gagctccgaggaataatccccaactcctttgctcatgtgttcggccacatcgccaaagca
gagggcgacacccggttcttagttcgcgtctcttatctggagatttacaatgaagaagtg
agggacctgctcgggaaggaccagatgcagaggctggaggtgaaggagaggccagatgtg
ggcgtttacatcaaggacctgtctggttatgtggtgaacaacgctgatgacatggacagg
attatgacaatggggcacaagaatcgctcggttggctccaccaacatgaatgaacacagc
tctcgctctcatgccatcttcaccatcaccatcgagtgcagtgagaagggcgtggatgga
gaccagcacgtacgcatgggaaaactccacttagtggatctggcgggttctgagcgtcag
gggaagacgggagcgacgggccagcggctgaaagaggccactaagatcaacctgtctctg
tccacgctgggtaacgtcatctcagctctggtggacgggaagagcacccacgtcccctac
aggaactccaaactcacccgcctgctgcaagactcactggggggaaactccaagaccatg
atggtaactaacaacacttcctgcttttacttcctgctgtggccatctcgtatggaattg
tccaggagcagtcacatcaacacatggcattggctcatttcttcgtcaacacatggcatt
ggctcatttcttcgtcaacacatggcattggctcatttcttcgtcaacacatggcattgg
ctcatttcttcgtcaacacatggcattggctcatttcttcgtcaacacatggcattggct
catttcttcgtcaacacatggcattggctcatttcttcgtcaacacatggcattggttca
gtggttgttgagaggttgttgttgtgttgtcagatggccgacctgcagcaggagcatcac
cgggagatcgagggcctgctggagaatatccgccacctcagcagagagctacgactgcag
atgctcatcatagacagcttcatcccacaggaataccaggagatgattgagaactatgta
cagtggaatgaggacattggggaatggcagctgaagtgtgtagcgtacactggtaacaac
atgaggaaacagacccccgtgccggacaagaaagagaaagatccgtttgagcttgacttg
tcccatgtgtacttggcctacacagaggagagtatgagacagtcactgatgaagctggag
aggcccaggtcctccaagagtagtaggcccaagactggacgaaggaaaagatcagcgaag
cccgaggctgtgatggaatccctgctgcagtga

DBGET integrated database retrieval system