KEGG   Salmo salar (Atlantic salmon): 106592905
Entry
106592905         CDS       T04363                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04080  Neuroactive ligand-receptor interaction
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106592905
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106592905
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sasa04030]
    106592905
G protein-coupled receptors [BR:sasa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    106592905
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 106592905
NCBI-ProteinID: XP_014039734
UniProt: A0A1S3QK52
LinkDB
Position
ssa02
AA seq 357 aa
MDKLTDDIPGCYYNRTVQFFYEHSGKNISAHWRPRDYVVVSLGMGVSVIVILANILVMVA
IFINRRFHFPIYYLLGNLAAADLFSGIAYLHLMFHTGPWTIKLSKNQWFVRQTLIDSSLT
ASVLNLLAIALERHQTIFTMQLHSKMTNRRVVLLIAAIWGLAIFMGLVPTMGWHCVCDLD
NCSTMAPMYQRSYLVFWAVLNLFTFSLMVAAYTRIFVYVRHKSQRMSQHTSQIRHKETVF
NLMKTVSMILGEEGRGAHTHTHTHYEKYCLVLAECNSLVNPIIYSFRDTDMLQTFKRILC
CLCRRGGAGHRDTLSGMRCNTLEQEVLSESNGNNHHDNHNDDNNHISPHGDHSDTDD
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggacaagttgacagatgacatccccgggtgctactacaaccgtacagtgcagttcttt
tacgaacatagtggcaagaacatcagcgcccactggcgtcctcgggactacgtggtggtg
agcctgggcatgggtgtgtctgtcatcgtcatcctggccaacatcctggtcatggtggcc
atcttcatcaaccgacgattccacttccctatctactatctgctaggcaacctggcggca
gcagacctgttctcaggtattgcctacctgcacctgatgttccacactgggccctggacc
atcaagctgtccaagaaccagtggtttgtacgccagaccctgatcgactccagtctgaca
gcatcggtgttgaacctcctggccatcgccttggagcgccaccagaccatcttcaccatg
cagctccacagtaagatgaccaaccgccgcgtggtgctgctcatcgccgctatctggggc
ctagccatcttcatgggcctggttcccaccatgggctggcactgtgtgtgtgacctggac
aactgctccaccatggcccccatgtaccaacgctcctacctggtgttctgggctgtgctc
aacctgttcaccttctctctcatggtggctgcctacaccaggatctttgtgtacgtcaga
cacaagagccagaggatgtctcagcacaccagccagatacgacacaaggagactgtgttc
aacctgatgaagactgtgtctatgatcctgggtgaggagggacggggggcacacacacac
acacacacacactatgagaagtactgtctggtcctggctgagtgtaactccctggtcaac
cccatcatctacagcttcagagacacggacatgttacagaccttcaagaggatcctctgc
tgcctgtgtcgccgcggcggcgccggccacagagacacgctgtccggcatgcgctgcaac
accctggagcaagaggtactctctgagagcaacggcaacaatcaccacgacaaccacaac
gacgacaacaatcatataagtccccacggcgaccactcggacacagacgattag

DBGET integrated database retrieval system