KEGG   Salmo salar (Atlantic salmon): 106593024Help
Entry
106593024         CDS       T04363                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00052  Galactose metabolism
sasa00500  Starch and sucrose metabolism
sasa01100  Metabolic pathways
sasa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106593024
   00500 Starch and sucrose metabolism
    106593024
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106593024
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106593024
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106593024
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106593024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 106593024
NCBI-ProteinID: XP_014039847
UniProt: A0A1S3QJ94
LinkDB All DBs
Position
ssa02
AA seq 328 aa AA seqDB search
MVSYKRLSPEDVQFSNAASSEEAPVQEMEEGKDPEETERPLLPRRPSCSATTALISLGSL
LLLVCGLWLLVTIFWLQAPSNSVPHRAPPPRGSPGTGGGDRGRALPEPQACGVVPEAWRF
DCYPERGVVVTRELCEARNCCFIPASSSSAPGRNGVPWCFYPPGFPSYSLVSVKATELGQ
TGTLVKTVKTYYPKDILTLHLELLYETDHRLRVRITDPSESRFEVPIAVPKATEKASSPA
YSVELSNEPFGIIVKRTSTGAVLLNTTVAPLFYCDQFLQLSSSLSSQYIYGLGEHRSSFL
HDIHWNTLTMWARDVPPTGHLGNTNQHF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcttataagagactgagtccagaggatgtccagttctccaacgctgcttcttca
gaggaggctcctgtacaggagatggaggaggggaaggacccagaggagacagagcgcccc
ctgctgcctcggaggccctcctgttctgccaccacggccctcatctccctgggctccctg
ctgctcctggtctgtggcctctggcttctggtgaccatcttctggctccaagccccctcc
aacagcgtcccccacagggctccgccgcccaggggctccccagggacgggtgggggagac
aggggtagagccctaccagagccccaggcttgtggagtggtcccagaggcctggaggttt
gactgctacccagagagaggggtggtggtgaccagggagttgtgtgaggcgaggaactgt
tgcttcatccctgcctcctcctcctccgccccggggaggaatggtgttccctggtgtttc
taccctcctgggttcccctcctactccctggtgtctgttaaggccacagagttgggtcag
acaggaacactggtgaagacggtgaagacctactaccctaaagacattctgaccttacat
ctggagctcctctatgagacagaccacaggctccgagtcaggatcaccgacccgtctgag
tcgcggttcgaggtgccaatcgccgtgcccaaggccacagagaaggcctctagtcccgcc
tactctgtggagctgtccaatgagccgtttggcatcatcgtcaagagaacgtccacagga
gctgtgctcctcaacaccacggtagcacctctgttctactgtgaccagttcctccagctg
tccagcagtctgtccagtcagtacatctatgggctgggagaacaccgctcctccttccta
cacgacatccactggaacactctcaccatgtgggctagagacgtaccacccacgggtcac
ctaggaaacaccaatcaacacttttag

DBGET integrated database retrieval system