KEGG   Salmo salar (Atlantic salmon): 106593072Help
Entry
106593072         CDS       T04363                                 

Gene name
gstz1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00350  Tyrosine metabolism
sasa01100  Metabolic pathways
Module
sasa_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106593072 (gstz1)
Enzymes [BR:sasa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     106593072 (gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 106593072
NCBI-ProteinID: XP_014039908
UniProt: A0A1S3QIP7
LinkDB All DBs
Position
ssa01
AA seq 220 aa AA seqDB search
MRLSLACLTKPILHGYFRSSCSWRVRIAFALKGIEFDQVPVNLIKDGGQQLTDQYKALNP
MQQVPAVQIDGITLSQSLAVIQYIEETRPGPRLLPADPKKRAQVRMISDLIASGIQPVQN
LYVLQKIGAEKLQWAQHFIQRGFEALEPILKETASKYCVGDEISMADICLVPQVYNAERF
KVDVDQFPTIKRLNQTLMKVDAFKVSHPSCQPDTPAELCT
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcggctctcactcgcatgcctcacaaagcccattcttcatggatatttcaggagttca
tgttcttggagggttcgaattgcttttgctctgaaaggtattgaatttgaccaagtccca
gtcaatcttatcaaagatgggggtcagcagcttacagaccaatacaaggcattaaaccct
atgcaacaagtgcctgctgtccaaattgatggcatcaccctgtcacagtcgctggcagtg
atccagtacattgaggagaccagaccaggacccaggcttctccctgcagacccaaagaag
cgtgcccaggtgcgcatgatctctgacctcatcgcctccgggatccagcctgtgcagaat
ttgtacgtgctacagaagattggagcagagaagttgcagtgggcgcagcatttcatccaa
agaggttttgaagccttggagcccattctgaaagagacggctagcaagtactgcgtaggg
gacgagatctccatggcagacatctgtctcgtccctcaagtctataatgctgaacggttc
aaagtggacgttgatcagttcccaactatcaaaaggctaaaccaaaccttaatgaaggta
gacgctttcaaagtgagtcatccatcttgccaaccagacacacctgctgaattgtgtaca
tga

DBGET integrated database retrieval system