KEGG   Salmo salar (Atlantic salmon): 106593284Help
Entry
106593284         CDS       T04363                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD2-like
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106593284
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106593284
Enzymes [BR:sasa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106593284
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106593284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET AWS
Motif
Other DBs
NCBI-GeneID: 106593284
NCBI-ProteinID: XP_014040097
UniProt: A0A1S3QJZ7
LinkDB All DBs
Position
Un
AA seq 2351 aa AA seqDB search
MDALVNSEIREEGGDTSVKVEGLTKAAILKGLSPRVMLSSHLLPKGTKRKVNLDDQGRQK
VSFSFSLTKKPLQNLFLAPPSQEKSLAELPSVLSPTTSLPQDRAGQHTESKNEQMQPPLL
VPTPVAEILAPQTAVSSVPKPKVDLGKMHFKKQILSASVIEESPITSVVLQDPPPSEQQV
LMESSGKIETVTPTRTLQSQNNLQNMDNDCPSENALTRVSDVKLDLSLKEPTDSSHKGKV
DVNTSSITEQQDTSENIQIRSRLDSTLPGSESDADSVQTSSSYKSGEPKATAKLESRSKD
TKNMSSSRSKLEETEKSSNHSRSEKDERNSSYSKSDRDSKSDRELRSTSDRESKHTPSRS
SRSDKGRRRTKSRSRSRSRGPRTSSRSETRSRSERSRSDRGSGSRSDRSYYDSERRSGGH
RSSPYRERRGSSRSRTDSSRVRGDSSDSEDDHRRTRTRTSDSSRSSTHSSLQRDSKSYSS
HSKSERDSKSERDSEIDKITQSSKSERASKRTVDSGSLQKCSTDVEPNHRKSNTHYKPDI
SVRSTHSSPHALSQTSDKRLQKSSCSESEVAHKGKSQSQGSDRSSGSEGAWTSSTSKSDS
KQMSASMSSVKTNRQSKDTFHSPNKIQTHETPSDAHPQSKNDKAGADPHVADTCQREDVG
NMNDITSQDKGLQKTTLSLPLNCDPTDRLQEPALDLLNEKIHHCIEVQNDSAATLPNSSS
GDQFCEKFALGDIDNVNKSLCSEQTKDAQRVDPQIESTEKWVDVTNSSFSCSNDRVIPSQ
DKTVFQGSVGSKSLPSTVSVRDHPKQNTKPENTVLCSSRNVNINMQSCKNVPLKSEPSSP
EPQFPNQTEQQNSSLRKNRGKTKKSRWDIVGQDTSDSDNPQKLPSQESKPAVKKVISVKR
IEFSKDVSQEDPSPKGQLKWEAELHSETIKQEIIITQEHSSALITFGNDQSDSANLTAQP
GTCETSSDRLDIKPHVSQMDGDPSLLNNTSHVDRARREQGRDDNEEKPKDGPHKSKLLKT
LVSSQDGVGQSEDSDTDDSESDSDCGVAVKRMHSVVVVPKNSTLTHSDTTDKPASPCTPS
TSPGRQQYANRASGQEGDLDRNEIPSRVSPQQRHRGFPAMCESTRQASNPCVGGSLSAHD
IMVYQSQSNMVDSTSQLEGSNATDAQPSKDPYSSARERPKIGAATVSQIAAHSLENSFRQ
SDTGHPQHYGSGKGGGMLSRYQHGDFASSDDFNSSLGWDFTQSEQPSSTYQQPDSSYGAS
QQHPNTQQPGNSSLGQVYRTNNGAYWTQLPTTAQPTCRPVYLHVPATHYQEPVGQVHPDS
LTNDCDEDSEGKPAGFSRLAVECNGPKLPGSLAFVQAHEISSNCRGSVNATPENISIVEP
PRDKDNSRPHRGRGPPKKRRPEMESDSDSEAEPVLASKRERLAEREIHKVSKESREIPGQ
AEVQRPLLSLRDFRDASNWREMARSKKMPPYFDLIEENLYLTERKKNKSHRDIKRMQCEC
SMLSREERSRGMMACGEDCLNRLLMIECSSRCLNEGYCSNRRFQMKQHADFEVILTEDKG
WGLRAARDLIPNTFVLEYCGEVLDHKEFKTRVKKYASMKNIHYYFMALKNNEIIDATLKG
NCSRFMNHSCEPNCETQKWTVNGQLRVGFFTSKTVTAGTELTFDYQFQRYGKEAQKCFCG
APSCRGFLGGENRVSVRAAAGKMKKERPRKKDTSVSNALTTVDEELEALLENGEGLYDEK
EVVSLCRLMVRVETMEQKLICLKLIQDTQSPSCLKQFLDHHGLSLLWIFMVELSEAKGNS
VNNIKLQFQIMKTLSVLPISTKNMLEESHVLSLIQRWAQTHTHSLPQPPGAEQDGYSSEN
TSRAQTPLNTPDGSSASVAKLGPELDSDTPKRAVYRRLKISENSLDSAMSDASKASDGKE
EEEEDEVFLKQGLRALQLKDIVVTVGERGGVGTLGRRKLKHAPPPPLRLDASCSSLSSPA
TSPTGSSLSSLDSAFSQYSTDYVTSAGFHLAEPSPHSPLSPRFPLSHLFPLSPRLPRSPQ
GSPPKRDTVDWSQSHPPHSSRTPSTHHGLYPNTWFKRDRRLSLRQPDNGHLEEEVGEGEG
VSLPKSPEVKGVEVTTKRRSSSPPSYQQAILQLQGSRSPFYRGTEKPLTVRELRLLHDQS
CKVTHRPPTGSDVTQQPTGIGSENIQPPQGVFYGQSSSTLTLQRHKSHSLTPAMEASRKV
FTMPRRASEPSCVTDAASSLTLERPRVKSRTHGVKDQQLPESGLRVSDVEPQRNGAGPNS
EPGICLSPSATRAVRDYFSSQGRVDSDACLGRSQEVALALVQGKREWQSRKCSDPCVDDF
DQMFFAEESYV
NT seq 7056 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctggtgaactcagagatcagggaagagggcggcgatacctcggtcaaggtt
gagggcctcaccaaggcagctatactcaaaggcctctcgcctcgagtgatgttgtccagc
catctcctgcctaaaggaaccaagaggaaggtgaacctggacgatcagggtcgccagaaa
gtgtctttcagcttctctctgacaaagaaaccgctgcagaacttattcctggcccctccc
agtcaggaaaaatctcttgctgagctcccctctgtcctgtcacctacaacctcactccct
caggacagagcaggacagcatacggaaagcaaaaatgagcaaatgcagccacccttgttg
gtgcccacaccagtagcagagatccttgcacctcagacggcagtatcctcagtccccaaa
cctaaagtggacttgggaaagatgcacttcaagaaacagattctcagtgcatctgttatt
gaagagagtcccataaccagtgttgtcttacaggatccacccccttccgagcaacaggtt
ttaatggaatcttcaggtaaaattgaaactgtcaccccaacacgaacgctccagtctcag
aacaatcttcagaacatggacaatgactgcccctctgagaatgcactcactcgtgtatct
gatgtgaagctggacctcagtctcaaggaaccgactgattcctcccacaaagggaaagtg
gatgtaaacacttccagtataacagagcagcaagacacctcagaaaacatacaaatccgt
tcccggttggacagcacactccctggctcagaatctgatgctgattcagtgcagacgtct
tctagctacaagtcaggtgaacccaaggccacagcaaagttggaaagtagaagtaaggat
acaaaaaatatgtcctcttctcgctccaaattagaggaaacagaaaaaagttctaaccat
tcacgttctgagaaggacgaaagaaactctagttactcaaaatctgaccgagattccaag
tctgaccgagaattaaggtcaacctctgaccgagaatcaaagcacacaccctcgcggtca
tcccgctctgacaaaggccgcagaaggactaagagtcggtcaaggtccagatcaagaggt
ccccggacaagttccagatctgagacacgctccagatctgagagatctagaagcgataga
gggtcaggatcacggtctgatcggtcatattacgactctgagcggaggtcaggaggtcac
agaagttctccgtacagagagaggagaggcagctctcgctctcggaccgatagcagcaga
gtccgcggcgacagttctgactctgaagatgaccacagaagaactcggactagaacaagt
gattccagcaggtcatccacccattctagcttgcagagagattcaaagtcatactcatct
cactcgaaatctgagcgagactcgaaatctgaacgcgattcagagatagataaaataaca
caatcttctaagtctgagagggcctcaaagagaactgttgactccggttccctccaaaag
tgctctactgatgtagaacctaatcacaggaaatccaacacccactacaagccggacatc
agtgttcgatccactcattccagtccacatgccctctctcaaacatcggacaaaaggctc
cagaaaagcagctgtagtgaatctgaggtagctcacaaagggaagtctcagtcacagggc
tctgaccgctcttctggctctgaaggggcatggacatcttccaccagtaaatcagactct
aagcaaatgtctgcctccatgtcatcagtgaaaactaatagacaatcaaaggacacattt
cacagtcccaataagatacaaacacatgaaaccccttctgatgctcaccctcagagcaaa
aatgacaaagcaggagcagatccccatgtagcagatacttgccagagggaggatgttggc
aacatgaatgacatcacatcccaagataaaggcttacaaaaaacaactctgtcgttacct
ttaaattgtgatccaactgacagattgcaagaaccagcgttggatctacttaatgagaag
atccatcattgcattgaggttcagaatgactcggcagcaactttaccgaacagctctagt
ggagaccaattctgtgaaaaatttgccttaggggacattgacaatgttaataaaagcctt
tgctctgaacaaacgaaagatgcacagcgtgtagacccccaaatagaatccactgagaag
tgggttgatgtaaccaactcgagcttttcctgcagtaatgacagagtaatacccagccag
gataagactgtttttcaaggttcagttgggtcaaagtcattaccatctacagtatctgtc
agagaccaccctaagcagaacactaaaccagaaaatactgtattgtgttctagtagaaat
gtgaatatcaacatgcagtcttgcaaaaacgtccctctcaaatctgaaccctccagtcct
gaacctcagtttcccaaccagactgaacaacagaactctagtttaaggaaaaacagaggt
aaaacaaaaaaatcgcgttgggatattgttggacaagatacctcagacagtgataatcct
cagaaattgccttcccaagaaagtaaacctgctgtgaaaaaggtcatctccgtcaagaga
attgagttttctaaagacgtcagccaggaagatccgtctccgaagggtcaactgaaatgg
gaagctgagttgcattccgagacgattaagcaagaaattattatcacacaagaacacagc
tcagcactaataacttttgggaacgaccaatcagattccgcaaacctaactgcacaacca
ggcacctgtgaaaccagcagtgaccgtttagacatcaaaccccacgtcagccaaatggat
ggagatccctcacttttaaataatacctcacatgtagacagagctagaagggagcagggt
agggatgataatgaagagaaacctaaagatggccctcacaagagcaaactgctgaagaca
ctagtgtcgagccaggacggtgtaggccaaagcgaggacagtgacactgacgattcagag
tcggactcagactgcggtgttgccgtgaaacggatgcactctgtggtggttgtaccaaag
aattccaccctgactcactcggacacaacagacaagcctgcgtctccctgcactccaagc
actagcccaggacgtcaacaatacgctaacagggccagtggccaagagggtgacctggac
aggaatgagatcccaagcagagtaagccctcagcagagacatagaggttttcccgccatg
tgtgagagcactaggcaggccagtaatccttgtgttggtggaagtctctctgcacatgac
atcatggtatatcaatcacagagcaacatggttgatagcaccagccagctcgagggctcc
aacgccaccgatgcccagccttctaaggatccttatagcagtgcccgtgagagaccaaag
attggtgccgcaacagtgagccagattgctgcccacagccttgagaactccttcaggcag
tctgacacagggcatccacagcattatggaagtggcaagggtggcgggatgctttcccgt
taccaacatggagactttgctagctctgatgacttcaacagcagtctgggctgggacttc
acacagtcggagcagcccagcagtacgtaccagcagcctgacagcagctatggggcatcc
caacagcatcctaacacacaacagccagggaactcttctttggggcaggtgtacaggaca
aacaatggggcctactggacccaactaccaactacggcccagcccacctgcagaccagtc
tacctccatgtgcctgcaacacattatcaggagcctgttggtcaagtccatcctgactcc
ctgactaatgactgcgatgaggacagcgaggggaaaccagcgggctttagtagactagct
gtggaatgcaatggtcccaagcttccaggctcgctagccttcgtacaagcccatgaaata
agcagcaactgcagaggctctgtcaacgccactccagagaatatttccatagttgaaccc
cccagagacaaggacaactcaaggccccacagaggcaggggtcctcccaagaaaaggcgg
ccagaaatggagtcagattcggacagcgaggcagaacctgtgctggctagcaaaagggag
cgactggcagaaagggagatccacaaggtctccaaagaatcccgggagattccaggtcag
gctgaagtgcaacgccctttgctcagtctgagggacttccgggacgccagcaactggagg
gagatggcaaggtctaagaagatgccaccatactttgacctgattgaggaaaacctgtat
ctgactgaacggaagaagaacaagtctcatcgagacatcaagcgaatgcagtgtgagtgc
tctatgctctcgagggaggagcggtctcgtggaatgatggcttgtggggaggactgcctt
aaccgtctgctgatgatcgagtgctcatcacgctgcctgaatgaaggctactgctccaac
cggcgcttccagatgaaacagcatgcagattttgaggtcatcctgactgaagataagggc
tggggactgagggcggccagggacctgataccaaacacttttgtgctggaatactgcgga
gaggtgttggaccacaaggagttcaagacacgggtgaaaaaatacgctagcatgaagaac
atccactactatttcatggccttgaagaataacgagatcatagatgccacactgaagggg
aactgctctcgctttatgaaccacagctgtgagcccaactgtgagacccagaagtggact
gtgaacggccagctgagagttgggttcttcacctccaagaccgtcacagctggtacagag
cttaccttcgattaccagttccagagatatgggaaagaggcccagaagtgcttctgtggg
gctcccagctgccgaggcttcctgggcggggagaaccgggtcagtgtaagagcagcggca
gggaagatgaagaaagagcgccctcgcaagaaggacacctccgtgagcaatgcactcact
acggtggacgaggaactagaggctctgctggagaacggggagggtctgtacgatgagaag
gaggtggtgtctctctgcaggctgatggtcagagtggagaccatggagcagaaactcatc
tgcctcaaacttatccaagatacccagagcccatcctgtctgaagcagttcctggaccat
cacggtctgtctctactgtggatcttcatggtggagctctctgaagccaagggcaacagt
gtcaacaacatcaaactgcagtttcagatcatgaagaccctgtcagtgctgcccatctcc
actaagaacatgttggaggagagtcatgtcctgagcctcatccagcgctgggcccaaaca
cacacacactccctcccccagccccctggggccgaacaggacggctactccagtgagaac
acgtcccgcgcccagacccctctcaacactcccgacggctcctctgcctccgtcgccaaa
ctgggccctgagttggacagcgacactcccaaacgggccgtttaccgtcgcctcaagatc
agcgagaacagcctggacagcgccatgtcggacgccagcaaggcctcggacggtaaggag
gaggaagaggaggatgaagtgtttctgaagcaggggctcagggctctgcagctgaaagac
attgtagtcacagttggagaaagaggaggggttggaactctcgggcggaggaagctgaag
cacgccccgccccctcctttacgattggatgcaagctgctccagcctgtcgtccccggcg
acctcccccacaggctcctccctcagctccctagactccgccttctcccagtattccaca
gactatgtcaccagcgccggcttccatttggctgagccttccccccactccccactctca
ccccgcttccccctctcacacctcttccccctctcaccccgcttaccccgctccccccag
ggctcaccccccaagagagacacagtggactggagccaaagccaccccccccactcctcc
cggaccccgtccacccaccacggcctgtaccccaacacttggttcaagagggaccgacgg
ctgtcgcttcggcaacccgacaacggacacttggaggaggaagttggggagggggaagga
gttagcctcccaaaatccccagaggttaaaggtgtagaggtgaccaccaagaggaggtcc
agtagccctccatcttaccagcaggctatcctacagctacaggggagtaggtctcccttc
tacagaggcacagagaaacccctcaccgtaagggagctacggctgctgcacgaccagtcc
tgcaaagtcacccacagaccccccacaggaagtgacgtcacccagcagcccactggaata
ggaagtgagaacatccagcccccccagggtgtgttctatggacagagtagctcaacactt
accctccagaggcataagtctcactccctcaccccggccatggaggccagccgcaaggtc
ttcaccatgcctcgcagagcctccgagccctcatgcgtgacagatgcagcctccagcctt
accctggagaggcccagggtcaagtcccggacccatggggtcaaagatcagcagctccct
gagagcggacttagagtctctgacgtggagccacagcgcaatggagcaggcccaaactca
gagccagggatctgcctatcaccctccgccacgcgggcagtgagggactacttttcctcg
caggggcgggtggattcagacgcatgcctaggtaggagtcaagaggtggctctggccctc
gtccaggggaagagggagtggcagagcaggaagtgcagtgatccgtgtgtcgacgacttt
gaccaaatgttctttgctgaggagtcctacgtttaa

DBGET integrated database retrieval system