KEGG   Salmo salar (Atlantic salmon): 106593772
Entry
106593772         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2-like
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106593772
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106593772
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106593772
  09143 Cell growth and death
   04110 Cell cycle
    106593772
   04115 p53 signaling pathway
    106593772
   04218 Cellular senescence
    106593772
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106593772
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106593772
   04121 Ubiquitin system [BR:sasa04121]
    106593772
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106593772
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106593772
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    106593772
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 106593772
NCBI-ProteinID: XP_014040623
UniProt: A0A1S3QKP2
LinkDB
Position
Un
AA seq 305 aa
MSLSLFKSGGDGEVVPNATSRPQALYIHNMKGVKDRMAENCERMSEWHRSSSQINTLDND
KLVRPKEKLHILLQQAGADKDVFTMKEVIFYLGQYIMKKQLYDMKQQHIVHCADDPLGAV
LGVDSFSVKEPRVLFAMITQNLLAVKNQESQSVFTEPRSQSEPDRGPKETDSDCHSSSTS
ERRRRRRSSDPDGTSSTQEEDGCESRKRHRSDSFSLTFDDSMSWCVIGGLRRDRRSSESS
DSHSNTEVGSLVSDVCDDVLSQDLDSDSDNFSVEFEVESIDSDAYSDPEEASVSGEDEVY
EVTIF
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtctctgagcctatttaaatccgggggagacggggaagtggttcctaatgctaccagc
cgacctcaagcactttatatacacaatatgaagggggtgaaagacagaatggcagagaat
tgtgagagaatgtcagaatggcatagaagtagttcccaaataaatactttggacaacgac
aaacttgtaagaccaaaagagaaactgcatatcttattacagcaggcaggtgcagacaaa
gacgttttcaccatgaaagaggtgatattctacctggggcagtacatcatgaagaaacag
ctttatgacatgaagcagcaacacatagtgcactgtgctgatgaccccctgggggctgta
ctgggagtggacagcttctctgttaaagaaccacgagtcctcttcgctatgatcacacaa
aatctcctagcagtgaaaaatcaagaatcccaatctgtcttcacggaacccaggagccag
agtgaaccggatagagggcctaaggagacagactcagactgtcattcatcatctacctca
gaacgcaggaggaggaggaggagtagtgaccctgatggaacatcatcgacacaagaggag
gacgggtgtgagtccaggaagagacataggtcagacagcttttctctgacctttgatgac
agcatgtcctggtgtgtgattggaggcctgagacgagaccgtaggagcagcgagtcttca
gactcacacagtaacactgaagtaggttcattggtcagtgacgtgtgtgacgatgttctg
agccaggatctggactcagactctgataacttcagcgtggagtttgaggtggagtccatc
gactcggatgcctacagcgatcccgaagaggcttcagtgtctggagaggacgaggtgtat
gaagtcaccatcttt

KEGG   Salmo salar (Atlantic salmon): 106594600
Entry
106594600         CDS       T04363                                 

Gene name
mdm2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106594600 (mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106594600 (mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106594600 (mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    106594600 (mdm2)
   04115 p53 signaling pathway
    106594600 (mdm2)
   04218 Cellular senescence
    106594600 (mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106594600 (mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106594600 (mdm2)
   04121 Ubiquitin system [BR:sasa04121]
    106594600 (mdm2)
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106594600 (mdm2)
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106594600 (mdm2)
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    106594600 (mdm2)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP FAM117 zf-RING_2 DZR
Other DBs
NCBI-GeneID: 106594600
NCBI-ProteinID: XP_014041481
UniProt: A0A1S3QND7
LinkDB
Position
Un
AA seq 386 aa
MITQNLLAVKNQESQSVFTEPRSQSEPDRGPKETDSDCHSSSTSERRRRRRSSDPDGTSS
TQEEDGCESRKRHRSDSFSLTFDDSMSWCVIGGLRRDRRSSESSDSHSNTEVGSLVSDVC
DDVLSQDLDSDSDNFSVEFEVESIDSDAYSDPEEASVSGEDEVYEVTIFEAEEEDSFDDD
TEITEADYWKCSKCEELNPPLPRNCNRCWTLRMDWFPESDSNSATTTLKPLPPKPSPAPT
EPDETEGLDVPDGKRAKSPLPLLKDSQDLVSVSGPDSQDSACSSQPSTSSSNSNGVGSGS
SSSAPFSQEVMVPDLERFNSLEAHLPASCLEPCVICQTRPKNGCIVHGRTGHLMACYTCA
RKLKKRNKLCPVCREPIQSVVLIYLS
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgatcacacaaaatctcctagcagtgaaaaatcaagaatcccaatctgtcttcacggaa
cccaggagccagagtgaaccggatagagggcctaaggagacagactcagactgtcattca
tcatctacctcagaacgcaggaggaggaggaggagtagtgaccctgatggaacatcatcg
acacaagaggaggacgggtgtgagtccaggaagagacataggtcagacagcttttctctg
acctttgatgacagcatgtcctggtgtgtgattggaggcctgagacgagaccgtaggagc
agcgagtcttcagactcacacagtaacactgaagtaggttcattggtcagtgacgtgtgt
gacgatgttctgagccaggatctggactcagactctgataacttcagcgtggagtttgag
gtggagtccatcgactcggatgcctacagcgatcccgaagaggcttcagtgtctggagag
gacgaggtgtatgaagtcaccatctttgaagcagaggaggaggactcgttcgatgacgac
actgaaatcacggaagcagactactggaagtgctcaaagtgtgaggagttgaaccctccc
ctcccccgtaactgtaaccgctgctggacactaagaatggattggtttcctgagtctgac
agcaactctgctaccaccaccctcaaacccttaccccccaagccttccccagccccgaca
gagcccgacgagaccgaaggactggatgtcccagatgggaagagagccaagtcgcccctt
cccctcctcaaagactcccaggacttggtgtccgtctctggtcccgattcccaagactcg
gcctgctcctcccagccctccacctcttcttcgaactccaatggtgtaggctcaggatcg
tcctctagcgcccccttcagccaagaagtgatggtaccagacctggagcgtttcaacagc
ctggaggctcacctccccgccagctgcctggagccctgcgtcatctgtcagaccaggccc
aagaacggctgcatcgtccacggacgcaccggacacctcatggcctgttacacctgcgcc
aggaaactgaagaagaggaacaagctgtgtcctgtctgcagggagcctatccagtctgtc
gtcctaatttatctcagctga

KEGG   Salmo salar (Atlantic salmon): 106597239
Entry
106597239         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2-like
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106597239
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106597239
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106597239
  09143 Cell growth and death
   04110 Cell cycle
    106597239
   04115 p53 signaling pathway
    106597239
   04218 Cellular senescence
    106597239
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106597239
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106597239
   04121 Ubiquitin system [BR:sasa04121]
    106597239
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106597239
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106597239
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    106597239
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 106597239
NCBI-ProteinID: XP_014043922
UniProt: A0A1S3QY54
LinkDB
Position
Un
AA seq 252 aa
MSLSLFKSGGDGEVVPNATSRPQALYIHNMKGVKDRMAENCERMSEWHRSSSQINTLDND
KLVRPKEKLHILLQQAGADKDVFTMKEVIFYLGQYIMKKQLYDMKQQHIVHCADDPLGAV
LGVDSFSVKEPRVLFAMITQNLLAVKNQESQSVFTEPRSQSEPDRGPKETDSDCHSSSTS
ERRRRRRSSDPDGTSSTQEEDGCESRKRHRSDSFSLTFDDSMSWCVIGGLRRDRRSSESS
DSHSNTVSSLLL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtctctgagcctatttaaatccgggggagacggggaagtggttcctaatgctaccagc
cgacctcaagcactttatatacacaatatgaagggggtgaaagacagaatggcagagaat
tgtgagagaatgtcagaatggcatagaagtagttcccaaataaatactttggacaatgac
aaacttgtaagaccaaaagagaaactgcatatcttattacagcaggcaggtgcagacaaa
gacgttttcaccatgaaagaggtgatattctacctggggcagtacatcatgaagaaacag
ctttatgacatgaagcagcaacacatagtgcactgtgctgatgaccccctgggggctgta
ctgggagtggacagcttctctgttaaagaaccacgagtcctcttcgctatgatcacacaa
aatctcctagcagtgaaaaatcaagaatcccaatctgtcttcacggaacccaggagccag
agtgaaccggatagagggcctaaggagacagactcagactgtcattcatcatctacctca
gaacgcaggaggaggaggaggagtagtgaccctgatggaacatcatcgacacaagaggag
gacgggtgtgagtccaggaagagacataggtcagacagcttttctctgacctttgatgac
agcatgtcctggtgtgtgattggaggcctgagacgagaccgtaggagcagcgagtcttca
gactcacacagtaacactgtgagtagcctcctcctgtaa

KEGG   Salmo salar (Atlantic salmon): 106597260
Entry
106597260         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2-like
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106597260
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106597260
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106597260
  09143 Cell growth and death
   04110 Cell cycle
    106597260
   04115 p53 signaling pathway
    106597260
   04218 Cellular senescence
    106597260
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106597260
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106597260
   04121 Ubiquitin system [BR:sasa04121]
    106597260
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106597260
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106597260
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    106597260
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 106597260
NCBI-ProteinID: XP_014043940
UniProt: A0A1S3QY54
LinkDB
Position
Un
AA seq 252 aa
MSLSLFKSGGDGEVVPNATSRPQALYIHNMKGVKDRMAENCERMSEWHRSSSQINTLDND
KLVRPKEKLHILLQQAGADKDVFTMKEVIFYLGQYIMKKQLYDMKQQHIVHCADDPLGAV
LGVDSFSVKEPRVLFAMITQNLLAVKNQESQSVFTEPRSQSEPDRGPKETDSDCHSSSTS
ERRRRRRSSDPDGTSSTQEEDGCESRKRHRSDSFSLTFDDSMSWCVIGGLRRDRRSSESS
DSHSNTVSSLLL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtctctgagcctatttaaatccgggggagacggggaagtggttcctaatgctaccagc
cgacctcaagcactttatatacacaatatgaagggggtgaaagacagaatggcagagaat
tgtgagagaatgtcagaatggcatagaagtagttcccaaataaatactttggacaatgac
aaacttgtaagaccaaaagagaaactgcatatcttattacagcaggcaggtgcagacaaa
gacgttttcaccatgaaagaggtgatattctacctggggcagtacatcatgaagaaacag
ctttatgacatgaagcagcaacacatagtgcactgtgctgatgaccccctgggggctgta
ctgggagtggacagcttctctgttaaagaaccacgagtcctcttcgctatgatcacacaa
aatctcctagcagtgaaaaatcaagaatcccaatctgtcttcacggaacccaggagccag
agtgaaccggatagagggcctaaggagacagactcagactgtcattcatcatctacctca
gaacgcaggaggaggaggaggagtagtgaccctgatggaacatcatcgacacaagaggag
gacgggtgtgagtccaggaagagacataggtcagacagcttttctctgacctttgatgac
agcatgtcctggtgtgtgattggaggcctgagacgagaccgtaggagcagcgagtcttca
gactcacacagtaacactgtgagtagcctcctcctgtaa

KEGG   Salmo salar (Atlantic salmon): 106597420
Entry
106597420         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2-like
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106597420
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106597420
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106597420
  09143 Cell growth and death
   04110 Cell cycle
    106597420
   04115 p53 signaling pathway
    106597420
   04218 Cellular senescence
    106597420
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106597420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106597420
   04121 Ubiquitin system [BR:sasa04121]
    106597420
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106597420
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106597420
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    106597420
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 106597420
NCBI-ProteinID: XP_014044087
UniProt: A0A1S3QY54
LinkDB
Position
Un
AA seq 252 aa
MSLSLFKSGGDGEVVPNATSRPQALYIHNMKGVKDRMAENCERMSEWHRSSSQINTLDND
KLVRPKEKLHILLQQAGADKDVFTMKEVIFYLGQYIMKKQLYDMKQQHIVHCADDPLGAV
LGVDSFSVKEPRVLFAMITQNLLAVKNQESQSVFTEPRSQSEPDRGPKETDSDCHSSSTS
ERRRRRRSSDPDGTSSTQEEDGCESRKRHRSDSFSLTFDDSMSWCVIGGLRRDRRSSESS
DSHSNTVSSLLL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtctctgagcctatttaaatccgggggagacggggaagtggttcctaatgctaccagc
cgacctcaagcactttatatacacaatatgaagggggtgaaagacagaatggcagagaat
tgtgagagaatgtcagaatggcatagaagtagttcccaaataaatactttggacaatgac
aaacttgtaagaccaaaagagaaactgcatatcttattacagcaggcaggtgcagacaaa
gacgttttcaccatgaaagaggtgatattctacctggggcagtacatcatgaagaaacag
ctttatgacatgaagcagcaacacatagtgcactgtgctgatgaccccctgggggctgta
ctgggagtggacagcttctctgttaaagaaccacgagtcctcttcgctatgatcacacaa
aatctcctagcagtgaaaaatcaagaatcccaatctgtcttcacggaacccaggagccag
agtgaaccggatagagggcctaaggagacagactcagactgtcattcatcatctacctca
gaacgcaggaggaggaggaggagtagtgaccctgatggaacatcatcgacacaagaggag
gacgggtgtgagtccaggaagagacataggtcagacagcttttctctgacctttgatgac
agcatgtcctggtgtgtgattggaggcctgagacgagaccgtaggagcagcgagtcttca
gactcacacagtaacactgtgagtagcctcctcctgtaa

KEGG   Salmo salar (Atlantic salmon): 106597562
Entry
106597562         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2-like
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106597562
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106597562
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106597562
  09143 Cell growth and death
   04110 Cell cycle
    106597562
   04115 p53 signaling pathway
    106597562
   04218 Cellular senescence
    106597562
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106597562
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106597562
   04121 Ubiquitin system [BR:sasa04121]
    106597562
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106597562
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106597562
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    106597562
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 106597562
NCBI-ProteinID: XP_014044204
UniProt: A0A1S3QY54
LinkDB
Position
Un
AA seq 252 aa
MSLSLFKSGGDGEVVPNATSRPQALYIHNMKGVKDRMAENCERMSEWHRSSSQINTLDND
KLVRPKEKLHILLQQAGADKDVFTMKEVIFYLGQYIMKKQLYDMKQQHIVHCADDPLGAV
LGVDSFSVKEPRVLFAMITQNLLAVKNQESQSVFTEPRSQSEPDRGPKETDSDCHSSSTS
ERRRRRRSSDPDGTSSTQEEDGCESRKRHRSDSFSLTFDDSMSWCVIGGLRRDRRSSESS
DSHSNTVSSLLL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtctctgagcctatttaaatccgggggagacggggaagtggttcctaatgctaccagc
cgacctcaagcactttatatacacaatatgaagggggtgaaagacagaatggcagagaat
tgtgagagaatgtcagaatggcatagaagtagttcccaaataaatactttggacaatgac
aaacttgtaagaccaaaagagaaactgcatatcttattacagcaggcaggtgcagacaaa
gacgttttcaccatgaaagaggtgatattctacctggggcagtacatcatgaagaaacag
ctttatgacatgaagcagcaacacatagtgcactgtgctgatgaccccctgggggctgta
ctgggagtggacagcttctctgttaaagaaccacgagtcctcttcgctatgatcacacaa
aatctcctagcagtgaaaaatcaagaatcccaatctgtcttcacggaacccaggagccag
agtgaaccggatagagggcctaaggagacagactcagactgtcattcatcatctacctca
gaacgcaggaggaggaggaggagtagtgaccctgatggaacatcatcgacacaagaggag
gacgggtgtgagtccaggaagagacataggtcagacagcttttctctgacctttgatgac
agcatgtcctggtgtgtgattggaggcctgagacgagaccgtaggagcagcgagtcttca
gactcacacagtaacactgtgagtagcctcctcctgtaa

KEGG   Salmo salar (Atlantic salmon): 106597585
Entry
106597585         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2-like
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106597585
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106597585
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106597585
  09143 Cell growth and death
   04110 Cell cycle
    106597585
   04115 p53 signaling pathway
    106597585
   04218 Cellular senescence
    106597585
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106597585
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106597585
   04121 Ubiquitin system [BR:sasa04121]
    106597585
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106597585
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106597585
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    106597585
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 106597585
NCBI-ProteinID: XP_014044225
UniProt: A0A1S3QY54
LinkDB
Position
Un
AA seq 252 aa
MSLSLFKSGGDGEVVPNATSRPQALYIHNMKGVKDRMAENCERMSEWHRSSSQINTLDND
KLVRPKEKLHILLQQAGADKDVFTMKEVIFYLGQYIMKKQLYDMKQQHIVHCADDPLGAV
LGVDSFSVKEPRVLFAMITQNLLAVKNQESQSVFTEPRSQSEPDRGPKETDSDCHSSSTS
ERRRRRRSSDPDGTSSTQEEDGCESRKRHRSDSFSLTFDDSMSWCVIGGLRRDRRSSESS
DSHSNTVSSLLL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtctctgagcctatttaaatccgggggagacggggaagtggttcctaatgctaccagc
cgacctcaagcactttatatacacaatatgaagggggtgaaagacagaatggcagagaat
tgtgagagaatgtcagaatggcatagaagtagttcccaaataaatactttggacaatgac
aaacttgtaagaccaaaagagaaactgcatatcttattacagcaggcaggtgcagacaaa
gacgttttcaccatgaaagaggtgatattctacctggggcagtacatcatgaagaaacag
ctttatgacatgaagcagcaacacatagtgcactgtgctgatgaccccctgggggctgta
ctgggagtggacagcttctctgttaaagaaccacgagtcctcttcgctatgatcacacaa
aatctcctagcagtgaaaaatcaagaatcccaatctgtcttcacggaacccaggagccag
agtgaaccggatagagggcctaaggagacagactcagactgtcattcatcatctacctca
gaacgcaggaggaggaggaggagtagtgaccctgatggaacatcatcgacacaagaggag
gacgggtgtgagtccaggaagagacataggtcagacagcttttctctgacctttgatgac
agcatgtcctggtgtgtgattggaggcctgagacgagaccgtaggagcagcgagtcttca
gactcacacagtaacactgtgagtagcctcctcctgtaa

KEGG   Salmo salar (Atlantic salmon): 106597621
Entry
106597621         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2-like
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106597621
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106597621
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106597621
  09143 Cell growth and death
   04110 Cell cycle
    106597621
   04115 p53 signaling pathway
    106597621
   04218 Cellular senescence
    106597621
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106597621
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106597621
   04121 Ubiquitin system [BR:sasa04121]
    106597621
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106597621
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106597621
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    106597621
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 106597621
NCBI-ProteinID: XP_014044257
UniProt: A0A1S3QY54
LinkDB
Position
Un
AA seq 252 aa
MSLSLFKSGGDGEVVPNATSRPQALYIHNMKGVKDRMAENCERMSEWHRSSSQINTLDND
KLVRPKEKLHILLQQAGADKDVFTMKEVIFYLGQYIMKKQLYDMKQQHIVHCADDPLGAV
LGVDSFSVKEPRVLFAMITQNLLAVKNQESQSVFTEPRSQSEPDRGPKETDSDCHSSSTS
ERRRRRRSSDPDGTSSTQEEDGCESRKRHRSDSFSLTFDDSMSWCVIGGLRRDRRSSESS
DSHSNTVSSLLL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtctctgagcctatttaaatccgggggagacggggaagtggttcctaatgctaccagc
cgacctcaagcactttatatacacaatatgaagggggtgaaagacagaatggcagagaat
tgtgagagaatgtcagaatggcatagaagtagttcccaaataaatactttggacaatgac
aaacttgtaagaccaaaagagaaactgcatatcttattacagcaggcaggtgcagacaaa
gacgttttcaccatgaaagaggtgatattctacctggggcagtacatcatgaagaaacag
ctttatgacatgaagcagcaacacatagtgcactgtgctgatgaccccctgggggctgta
ctgggagtggacagcttctctgttaaagaaccacgagtcctcttcgctatgatcacacaa
aatctcctagcagtgaaaaatcaagaatcccaatctgtcttcacggaacccaggagccag
agtgaaccggatagagggcctaaggagacagactcagactgtcattcatcatctacctca
gaacgcaggaggaggaggaggagtagtgaccctgatggaacatcatcgacacaagaggag
gacgggtgtgagtccaggaagagacataggtcagacagcttttctctgacctttgatgac
agcatgtcctggtgtgtgattggaggcctgagacgagaccgtaggagcagcgagtcttca
gactcacacagtaacactgtgagtagcctcctcctgtaa

KEGG   Salmo salar (Atlantic salmon): 106597741
Entry
106597741         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2-like
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106597741
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106597741
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106597741
  09143 Cell growth and death
   04110 Cell cycle
    106597741
   04115 p53 signaling pathway
    106597741
   04218 Cellular senescence
    106597741
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106597741
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106597741
   04121 Ubiquitin system [BR:sasa04121]
    106597741
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106597741
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106597741
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    106597741
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 106597741
NCBI-ProteinID: XP_014044361
UniProt: A0A1S3QY54
LinkDB
Position
Un
AA seq 252 aa
MSLSLFKSGGDGEVVPNATSRPQALYIHNMKGVKDRMAENCERMSEWHRSSSQINTLDND
KLVRPKEKLHILLQQAGADKDVFTMKEVIFYLGQYIMKKQLYDMKQQHIVHCADDPLGAV
LGVDSFSVKEPRVLFAMITQNLLAVKNQESQSVFTEPRSQSEPDRGPKETDSDCHSSSTS
ERRRRRRSSDPDGTSSTQEEDGCESRKRHRSDSFSLTFDDSMSWCVIGGLRRDRRSSESS
DSHSNTVSSLLL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtctctgagcctatttaaatccgggggagacggggaagtggttcctaatgctaccagc
cgacctcaagcactttatatacacaatatgaagggggtgaaagacagaatggcagagaat
tgtgagagaatgtcagaatggcatagaagtagttcccaaataaatactttggacaatgac
aaacttgtaagaccaaaagagaaactgcatatcttattacagcaggcaggtgcagacaaa
gacgttttcaccatgaaagaggtgatattctacctggggcagtacatcatgaagaaacag
ctttatgacatgaagcagcaacacatagtgcactgtgctgatgaccccctgggggctgta
ctgggagtggacagcttctctgttaaagaaccacgagtcctcttcgctatgatcacacaa
aatctcctagcagtgaaaaatcaagaatcccaatctgtcttcacggaacccaggagccag
agtgaaccggatagagggcctaaggagacagactcagactgtcattcatcatctacctca
gaacgcaggaggaggaggaggagtagtgaccctgatggaacatcatcgacacaagaggag
gacgggtgtgagtccaggaagagacataggtcagacagcttttctctgacctttgatgac
agcatgtcctggtgtgtgattggaggcctgagacgagaccgtaggagcagcgagtcttca
gactcacacagtaacactgtgagtagcctcctcctgtaa

KEGG   Salmo salar (Atlantic salmon): 106597762
Entry
106597762         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2-like
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106597762
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106597762
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106597762
  09143 Cell growth and death
   04110 Cell cycle
    106597762
   04115 p53 signaling pathway
    106597762
   04218 Cellular senescence
    106597762
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106597762
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106597762
   04121 Ubiquitin system [BR:sasa04121]
    106597762
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106597762
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106597762
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    106597762
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 106597762
NCBI-ProteinID: XP_014044379
UniProt: A0A1S3QY54
LinkDB
Position
Un
AA seq 252 aa
MSLSLFKSGGDGEVVPNATSRPQALYIHNMKGVKDRMAENCERMSEWHRSSSQINTLDND
KLVRPKEKLHILLQQAGADKDVFTMKEVIFYLGQYIMKKQLYDMKQQHIVHCADDPLGAV
LGVDSFSVKEPRVLFAMITQNLLAVKNQESQSVFTEPRSQSEPDRGPKETDSDCHSSSTS
ERRRRRRSSDPDGTSSTQEEDGCESRKRHRSDSFSLTFDDSMSWCVIGGLRRDRRSSESS
DSHSNTVSSLLL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtctctgagcctatttaaatccgggggagacggggaagtggttcctaatgctaccagc
cgacctcaagcactttatatacacaatatgaagggggtgaaagacagaatggcagagaat
tgtgagagaatgtcagaatggcatagaagtagttcccaaataaatactttggacaatgac
aaacttgtaagaccaaaagagaaactgcatatcttattacagcaggcaggtgcagacaaa
gacgttttcaccatgaaagaggtgatattctacctggggcagtacatcatgaagaaacag
ctttatgacatgaagcagcaacacatagtgcactgtgctgatgaccccctgggggctgta
ctgggagtggacagcttctctgttaaagaaccacgagtcctcttcgctatgatcacacaa
aatctcctagcagtgaaaaatcaagaatcccaatctgtcttcacggaacccaggagccag
agtgaaccggatagagggcctaaggagacagactcagactgtcattcatcatctacctca
gaacgcaggaggaggaggaggagtagtgaccctgatggaacatcatcgacacaagaggag
gacgggtgtgagtccaggaagagacataggtcagacagcttttctctgacctttgatgac
agcatgtcctggtgtgtgattggaggcctgagacgagaccgtaggagcagcgagtcttca
gactcacacagtaacactgtgagtagcctcctcctgtaa

KEGG   Salmo salar (Atlantic salmon): 106609861
Entry
106609861         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2-like
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106609861
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106609861
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106609861
  09143 Cell growth and death
   04110 Cell cycle
    106609861
   04115 p53 signaling pathway
    106609861
   04218 Cellular senescence
    106609861
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106609861
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106609861
   04121 Ubiquitin system [BR:sasa04121]
    106609861
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106609861
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106609861
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    106609861
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 106609861
NCBI-ProteinID: XP_014064358
UniProt: A0A1S3QY54
LinkDB
Position
ssa07
AA seq 252 aa
MSLSLFKSGGDGEVVPNATSRPQALYIHNMKGVKDRMAENCERMSEWHRSSSQINTLDND
KLVRPKEKLHILLQQAGADKDVFTMKEVIFYLGQYIMKKQLYDMKQQHIVHCADDPLGAV
LGVDSFSVKEPRVLFAMITQNLLAVKNQESQSVFTEPRSQSEPDRGPKETDSDCHSSSTS
ERRRRRRSSDPDGTSSTQEEDGCESRKRHRSDSFSLTFDDSMSWCVIGGLRRDRRSSESS
DSHSNTVSSLLL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtctctgagcctatttaaatccgggggagacggggaagtggttcctaatgctaccagc
cgacctcaagcactttatatacacaatatgaagggggtgaaagacagaatggcagagaat
tgtgagagaatgtcagaatggcatagaagtagttcccaaataaatactttggacaatgac
aaacttgtaagaccaaaagagaaactgcatatcttattacagcaggcaggtgcagacaaa
gacgttttcaccatgaaagaggtgatattctacctggggcagtacatcatgaagaaacag
ctttatgacatgaagcagcaacacatagtgcactgtgctgatgaccccctgggggctgta
ctgggagtggacagcttctctgttaaagaaccacgagtcctcttcgctatgatcacacaa
aatctcctagcagtgaaaaatcaagaatcccaatctgtcttcacggaacccaggagccag
agtgaaccggatagagggcctaaggagacagactcagactgtcattcatcatctacctca
gaacgcaggaggaggaggaggagtagtgaccctgatggaacatcatcgacacaagaggag
gacgggtgtgagtccaggaagagacataggtcagacagcttttctctgacctttgatgac
agcatgtcctggtgtgtgattggaggcctgagacgagaccgtaggagcagcgagtcttca
gactcacacagtaacactgtgagtagcctcctcctgtaa

DBGET integrated database retrieval system