KEGG   Salmo salar (Atlantic salmon): 106598858Help
Entry
106598858         CDS       T04363                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00020  Citrate cycle (TCA cycle)
sasa00190  Oxidative phosphorylation
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
Module
sasa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sasa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sasa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106598858
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106598858
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106598858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 106598858
NCBI-ProteinID: XP_014045346
UniProt: A0A1S3QZM3
LinkDB All DBs
Position
Un
AA seq 282 aa AA seqDB search
MDPSHRFRSNNTVIATGGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGCGPE
KDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VITHPDGEDKVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALTIADTCTPGEK
LSPLKPSAGEESVANLDKIRFADGNTRTSEIRLNMQRVRNTC
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggatccatcccaccgctttagatccaacaacactgtcatcgctactggtggttatggc
cgtacctacttcagctgtacctcagcccacaccagcaccggggatggcaacgccatggta
accagagctggcctaccatgccaggacctggagtttgtacagttccaccccaccggtatc
tatggtgccggctgcctcatcactgagggttgccgtggcgagggagggatcctcatcaac
agtgaaggagagcgctttatggaacgctacgctcccaacgccaaagatctggcctcccgg
gatgtggtgtcacgctccatgaccattgagatccgcgagggaaggggttgtggtccagaa
aaggaccatgtgtacctgcagttgcatcacctgcccccccagcagctggccacccgcctg
cctggtatctctgagaccgccatgatcttcgctggggttgacgtcaccaaagagcccatc
cctgtcctgcccaccgtccactacaacatgggaggaatccccaccaactataagggacag
gtcataactcatccagatggggaggacaaggtggtgccagggctgtatgcctgtggtgag
gctgcctgtgccagtgtccacggtgccaaccggctgggtgccaactccctgctggatctg
gtggtgtttggcagagcctgtgccctcaccatcgctgacacctgcactccaggtgagaag
ctttccccactgaagcccagtgctggagaggagtctgtggccaacctggacaagatcagg
tttgctgacgggaacaccagaacctctgagatcagactcaacatgcagagagtgaggaat
acatgttga

DBGET integrated database retrieval system