KEGG   Salmo salar (Atlantic salmon): 106601086
Entry
106601086         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase MGRN1-like
  KO
K10604  E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106601086
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106601086
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106601086
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106601086
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    106601086
SSDB
Motif
Pfam: zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_5 zf-C3HC4_2 zf-RING_11
Other DBs
NCBI-GeneID: 106601086
NCBI-ProteinID: XP_014048470
UniProt: A0A1S3R7X8
LinkDB
Position
ssa03
AA seq 551 aa
MGSILSRRIAGVEDIDIQANSAYRFPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDL
NFLGNRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDTDAPVEEGGKPKVLYGV
EFTFDADARVAITLYCQAFEEFTNGMAMYNPKGPALVSETVHYKRGVSQHFSLPSFKIDF
TDWKEEDLNFDLDRGVFPVVIQAVVDEGDDCLGHAHVLLAAFERHVDGSFSVKPLKQKQI
VDRVSYLLQEIYGIENKNNQETKPSEDENSDNSNECVVCLSDLRDTIILPCRHLCLCNSC
ADTLRYQANNCPICRLPFRALLQIRAVRKKPGPLSPVSFSPVLAQTMDHDEHSSSDSVPP
GFEPISLLEALNGLHSVSPSIPPAPLYDDINFSGSLVGEGRPLGSPEHSGDGGLQKGKVS
KSPDSTLRSPSSPIQEEDEEKLSEMSDAQPHTLLSSSPAPTEATAAEDVPESISPDDEDR
LHSGGEREILHDYSSEHSSLTKTESDPPGDLSLRGSSESTESLKSQSTNCSSQPLLCPPS
SLHMEDEQLDP
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgggatcgattcttagccggagaatcgctggcgttgaggatattgatatccaggcgaat
tcagcatacagatttccaccgaaatcggggaattactttgccagccattttttcatggga
ggggagaaatttgacactccccatccagagggttacctatttggagaaaacatggatctg
aacttccttggaaataggcctgtacaatttccgtacgtgacccctgcaccccatgagcct
gtgaagaccctgagaagtctggtcaatatcagaaaggactccctgcgcttggtcaggtac
aaagatgacactgacgctccagtagaggaaggaggcaagccaaaggttctgtatggtgtg
gagttcacatttgacgctgatgctcgtgtggctatcaccctgtattgccaagcttttgag
gaattcaccaatgggatggcaatgtacaacccaaagggcccagccctggtttctgagact
gtacactataagaggggtgtgagccaacatttctccctgccttctttcaaaatcgatttc
accgactggaaggaggaggatctgaactttgacctggacaggggtgttttccccgtggtg
atccaagctgtggtggatgaaggggatgattgcttgggacatgcacatgtgctgctggca
gcctttgagagacatgtggatggcagtttctccgtcaagcctctgaagcagaagcaaatt
gtggatcgtgtcagctacctgctgcaggagatctatggaattgaaaacaaaaacaaccaa
gagaccaagccgtcggaggatgagaacagtgacaacagcaatgagtgtgttgtttgtctg
tcagacctccgagacaccatcatcctgccctgcagacacctgtgtctctgcaactcctgt
gctgacaccctgcgttaccaggccaacaactgccctatctgcagactgcccttccgagcc
ttgctgcagatcagagctgtgagaaagaagcctgggccgctgtcccctgtgtctttcagc
cctgtattggctcagaccatggaccatgatgagcactcgagctcagactcggttccccca
ggctttgagcccatctctctgctggaggccctgaacggcctgcactctgtgtccccctcc
attccccccgcacccctctacgatgatattaacttctctgggagcctggtaggggagggt
cggccgctgggctccccagaacactccggggacgggggcctgcagaagggcaaagtcagc
aagtcacctgacagcaccctgaggtcgccctcatcacccatccaggaggaggatgaggag
aagctgtctgagatgtcggacgcccagcctcacaccctgctctccagcagccctgcaccc
accgaggccactgcagccgaggatgtaccagagtccatctccccagatgatgaggacagg
ctgcactctggaggagagagagagatccttcacgactacagcagtgaacacagcagcctg
accaaaacagagagtgacccgccaggggacctgtctctgcgggggtcatcagagtcaaca
gagagcctaaagagtcagagtaccaactgctccagccagcccctcctctgtccccccagc
agccttcacatggaggatgagcaacttgacccctaa

KEGG   Salmo salar (Atlantic salmon): 106607363
Entry
106607363         CDS       T04363                                 

Definition
(RefSeq) probable E3 ubiquitin-protein ligase MGRN1
  KO
K10604  E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106607363
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106607363
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106607363
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106607363
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    106607363
SSDB
Motif
Pfam: zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_5 zf-C3HC4_2 zf-RING_11
Other DBs
NCBI-GeneID: 106607363
NCBI-ProteinID: XP_014059742
UniProt: A0A1S3S5X7
LinkDB
Position
ssa06
AA seq 551 aa
MGSILSRRIAGVEDIDIQANSAYRFPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENLDL
NFLGNRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDTDAPVEEGGKPKVLYGV
EFTFDADARVAITLYCQAFEEFTNGMAMYNPKGPALVSETVHYKRGVSQHFSLPSFKIDF
TDWKEEDLNFDLDRGVFPMVIQAVVDEGDDCLGHAHVLLAAFERHVDGSFSVKPLKQKQI
VDRVSYLLQEIYGIENKNNQETKPSEDENSDNSNECVVCLSDLRDTIILPCRHLCLCNSC
ADTLRYQANNCPICRLPFRALLQIRAVRKKPGPLSPVSFSPVLAQTMDHDEHSSSDSVPP
GFEPISLLEALNGLHSVSPSIPPAPLYDDINFSGSLVGEGRPLGSPEHSGDGGLQKGKVS
KSPDSTLRSPSSPIQEEDEEKLSEMSDAQPHTLLSSSPAPTEATAAEDVPESISPDDEDR
LHSGGEREILQDYSSEHSSLTKTESDPPGDLSLPGSSESTESLKSQSTNCSSQPLLCPPS
SLHMEDEQLDP
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggggtcgattcttagccggagaatcgctggcgttgaggatattgatatccaggcgaat
tctgcgtacagatttccaccgaaatcggggaattactttgccagccattttttcatggga
ggggagaaatttgacactccccatccagagggttacctatttggagaaaacctggatctg
aacttccttggaaataggcctgtacaatttccgtacgtgaccccggcaccccatgagcct
gtgaagaccctgagaagtctggtcaatatcagaaaggactccctgcgcttggtcaggtac
aaagatgacacggatgctccagtagaggaaggagggaagccaaaggttctgtatggtgtg
gagttcacatttgacgctgatgctcgtgtggctatcaccctgtattgccaagcttttgag
gaatttaccaatgggatggcaatgtacaacccaaagggcccagccctggtttctgagact
gtacactataagaggggtgtgagccaacatttctccctgccttctttcaaaatcgatttc
accgactggaaggaggaggatctgaactttgacctggaccggggtgttttccccatggtg
atccaagctgtggtggatgaaggggatgattgcttgggacatgcacatgtgctgctggca
gcctttgagagacatgtggatggcagtttctccgtcaagcctctgaagcagaagcaaatt
gtggatcgtgtcagctacctgctgcaggagatctatggaattgaaaacaaaaacaaccaa
gagaccaagccgtcggaggatgagaacagtgacaacagcaatgagtgtgttgtttgtctg
tcagacctccgagacaccatcatcctgccctgcagacacctgtgtctctgcaactcctgt
gctgacaccctgcgttaccaggccaacaactgtcctatctgcagactgcccttccgagcc
ttgctgcagatcagagctgtgaggaagaagcctgggccgctgtcccctgtgtctttcagc
cctgtactggctcagaccatggaccatgatgagcactcgagctcagactcggttccccca
ggctttgagcccatctctctgctggaggccctgaacggcctgcactctgtgtccccctcc
atcccccccgcccccctctacgatgatattaacttctctgggagcctggtaggggagggc
cggccgctgggctccccagaacactccggggacgggggcctgcagaagggcaaagtcagc
aagtcacctgacagcaccctgaggtcgccctcatcacccatccaggaggaggatgaggag
aagctgtctgagatgtcggacgcccagcctcacaccctgctctccagcagccctgctccc
accgaggccactgcagccgaggatgtaccagagtccatctccccagatgatgaggacagg
ctgcactctggaggagagagagagatccttcaggactacagcagtgaacacagcagcctg
actaaaaccgagagtgacccgccaggggacctgtctctgccagggtcatcagagtcaaca
gagagcctgaagagtcagagtaccaactgctccagccagcccctcctgtgtccccccagc
agccttcacatggaggatgagcaacttgacccctaa

DBGET integrated database retrieval system