KEGG   Salmo salar (Atlantic salmon): 106601577Help
Entry
106601577         CDS       T04363                                 

Definition
(RefSeq) uncharacterized LOC106601577
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106601577
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106601577
Enzymes [BR:sasa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106601577
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106601577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 106601577
NCBI-ProteinID: XP_014049360
UniProt: A0A1S3RAH3
LinkDB All DBs
Position
ssa03
AA seq 2246 aa AA seqDB search
MDGCSKMSVMELCETDDLATSLVLDPLLGFSTHKMNVSPPPEVRRWGYLKETLLRFQRTH
DLQATFEALTVGDWACDYFTGLGTHRLELLKQHVYRYLCAFLLDSGVQIESCDRYSSETN
GAKITSTKHWFVGERMEVLLGCIAELSPADSAVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCRPNCKFVPGDKNGGCVKVVRPIAPGEEITCYYGDSFFGEDNEMCECCTCERKGE
GHFRHRERQPGCDDSNDLSGQKYRLRDTDLRLNRGKAPCPPTFRPTFTFSNSAIPSRNSF
TQQMKRNALMMSRKTKRLKQEGQRRISGMKQQRLIMPSLSEVVLRNLRVRVRRHTFNFLL
SCKDPTSKERALLHQLEHVETKDKWRKEQSALCCTTKENDKKEKSSNTCELNLKPFTLHP
SLSSQQNAGPAVCGQILGGKPLRVVEKVSVQTRISSRTRSMIRNCHTRQSVSRAKKNNKI
ISKRIELTKPICRKSNSASPQKHMDSCSGKDATHNVIGDIHGTNCITIENNTSGNNNDVA
YISNRTYTGGGGPKGSKAQGADQKPVDLKVEIKTIGESGTDGTLVASKPSGKRVEVCQSA
LDKAKKPGNHQKPISTPLVTTTPSTISLSSPSLDHVPVMSGLKQVTVSLIRVSVPGSVAE
ERACPGLEGKGIVRRESSVPVQAEQMARSATQGGEADTRVSRSQQKSMEEAGRELSDAEG
KKGVREMYFKAKANKVDVGRGQIAVVKVDVLHGEKGAGEKVIEIEAAGGGEQVSVAGNGH
RGSVKDIDRGAKLISKSVQSQVVGCDKRVLRGRNDAEEQSNGKAGGQNSKSCDSIIRKDG
GKNEKVSEMVKKGSSIAMDKKGVVIKQVRVLLSDILRKERDQKAGGSGSGNTGKKDLISS
NHKQMEDGREANNDGGKEVREQIYDAQTNSLPHATTQSGIISKRGKGRASKMKLEGPGQD
LHIHSPQSNDDLIPAKDRLSKSPPPSSEYLQTHTQANIPLKKRMFRNSVETDSEQSINSP
VSEPSSKDLKPSTELRQNLTLCSGRETKAIKVLEDRGRGGLRSNSDPKSTVSEFGVQSRT
QTFKRTGKQNATPRMLRPRVNQLEQDRPRRSAGKYKRGTRDSEVLENESDEDKHKVGHDE
ISLDSKKEHVNEGENKPESHTELLNSLTSQTCKEENGKGQSLNFKIRFKRKRGKVWELDR
PAGGEDLIIEAEKSIDSQQLEPYRAILDSVSILNLEMEKGAQADGKETHDVRFWKRRKVR
RDRLGSLKDRGPILMNRQSEVVAVDSKEKEKEQGELSEVEISEVLDEVIYGVKQLPGEKG
HTTSSEGISVGVGGLQCDYQVTPSPVRICEKEKDIPSLAEDGEQVKDTCIGVESSLVDSG
ALHEHKVKDEDQPLPRIKLRRKIQGVWEVDSQELEQSEAESEKEKKEMTCVKPKEECPSQ
PPTCQKLNSAIKCNTLKDSSAVLLKKEPPPLTLSLSTLTLNSPQPVGSDVMAYAPETMND
RAMPKITNRGGRGRGRGRKERQKTETARKVATGEMGTSCLSHNLLQIDNSLSRLSEGLCQ
SQSLEKNIPSDYTASTSKIPSQSQSQSPPFSFPERMLSTESSFANCCEDLLDFQCLNLEG
FYHPQNILQTSPIDLCPMDPPSGPFSSPLSHSPSDAWNPETPYLGPPSPGSIFNAEDQQF
LNGLVCSKNESLPLDCGVKDASKDRGQLNANFCFTSLSSAEGTFMDRFLMKNPGMKLSKE
DSKTQALSSAAKTHYSQKESFMFNTNTPSIGSHSQNTPVNVLNQSTNGTKASSAHSNFSK
VQPQVKTPGPFHLMSSSNKSQSFSTSQPVPSSFKTGPQNYSVKSVHSPQVVSNKFGSQLN
PNVGDAFRNTHDKSSSVIQSVLKFQGGKPSQNLNSAPSKVNIVAGNPKIAAKPHIAKSRY
SDTDKVHQSNKCSGFSTGGHKGSVPSYSIISGKDPVRLNASNYPIKSNLPNDKVHPDYFQ
TSSKSTTTTLEKPPSDKPQYTETSFGSKNFSTLPRPFFFPSQAPQSYGSPHGKHLNQDKP
CAAVHSQNPHSSYATSASPDKLCYDSSDLTFSTSLSPSMSQHNSPQVAHSSPSGSQTPAN
KQQPPSSSFSYSYGHQGPPYVVNFTGDHSVTMGLGDYPGSPPTNYTYRCLMEPSGTQGRL
VLEPCGPQLSHSPSFSVGGFSGLKGQDDHCKRDTQQQCQPIDHPPTSHHAPTSSHSLSTP
VSDRKPKRLRLVVTDGLVDLDLQYTD
NT seq 6741 nt NT seq  +upstreamnt  +downstreamnt
atggacggatgcagtaaaatgagtgtgatggagctgtgtgagacggatgatctggccacc
agcttggtgctggaccccttgctggggttcagcacccataaaatgaacgtcagtcccccc
ccagaggtccgtcgttggggctacctcaaagagactctgctacgcttccaacgcacacat
gatttgcaggccacctttgaggcccttacagtgggagactgggcctgtgactacttcact
ggactgggaacacaccgtctggaactactgaaacagcatgtgtatcgctacctctgtgcc
ttcctgttggatagtggtgtccagattgagtcatgtgaccgatactcttcagaaaccaac
ggagcaaagataacctctaccaagcactggtttgtaggtgagaggatggaggttctgttg
ggttgtatagccgagctgagtccagcagacagtgctgttctgagagcaggggtgaatgac
tttagtgtgatgtactccactcgtaagcgctgtgcacaactctggcttgggcctgcggct
ttcatcaaccacgactgcagaccaaactgtaagtttgttcctggcgataagaatggaggc
tgtgtaaaagtggtgaggcccatcgcacctggggaggagatcacctgttactatggcgac
agcttttttggagaagacaatgaaatgtgtgaatgctgcacctgtgagagaaaaggagag
ggtcacttccgacacagagagaggcagcctggttgtgatgactctaatgacctgtctggc
cagaagtaccgcctcagagacacagaccttcgtcttaacagagggaaagcaccctgtcct
cctacatttcggcctacatttacattttcaaattcagctatcccttcaaggaattcattt
acccagcagatgaagagaaatgctctgatgatgagcaggaagaccaaaaggttgaaacag
gaggggcaaaggaggatatcgggaatgaagcagcaacggctgataatgccatccctatca
gaggtggtgttgaggaaccttagggtccgagtacggcgccacacgttcaacttcttgttg
agctgcaaggaccccaccagcaaagagagggccttgctgcaccagcttgaacatgtggag
acaaaagacaagtggaggaaggaacaatctgctctctgctgtacaaccaaagagaatgac
aaaaaagagaagagcagcaatacttgtgagttaaacctgaagcctttcactcttcaccct
tccttgtcttctcaacagaatgctggaccagcagtttgtggacagatactgggtggcaag
ccccttcgagtggtggaaaaagtatctgtccagacaaggatctcttctagaacaaggagc
atgatcagaaactgtcacacacgccagtctgtttccagagccaagaagaacaacaaaatc
attagcaagcgcattgaactcaccaaacccatttgcagaaaaagcaacagcgcaagtcct
cagaaacacatggatagctgtagtggaaaagatgccacgcacaatgttatcggagatatt
catggaaccaattgcataaccatcgaaaataacaccagcggcaacaacaatgatgtggca
tacatcagcaacagaacatacactggtggaggcgggcccaaaggcagcaaggctcagggt
gcagatcagaaaccagtggatctgaaagtggaaatcaaaaccattggagaatcggggact
gatgggacactcgtggcgagcaaaccctctggtaaaagggttgaagtttgccaaagtgct
ttggacaaagccaagaagcctgggaatcaccagaaacccattagtactccccttgtcact
accacccctagcaccatttctctctcttccccctcacttgaccatgttccagtaatgtca
ggactgaagcaagtcacagttagcttgataagagtgtctgtgccgggaagtgtagcagaa
gaaagggcctgtccaggattggagggaaagggcattgtgagaagagagagcagcgtacca
gtgcaagcagaacagatggctagatcagctacacagggaggagaggcagacaccagagtg
tccaggtcccagcagaagtccatggaggaagcaggcagagagttgtcagacgctgaaggt
aagaaaggggtgagggaaatgtatttcaaggctaaggctaacaaagttgatgtaggaagg
ggacagattgctgtggtgaaagtcgatgtattacatggtgagaaaggggcaggtgagaag
gtcattgaaatagaagctgctggtgggggggaacaggttagtgtggctgggaacgggcat
agggggagtgtaaaagacattgacagaggggcaaaactaattagtaaaagtgtacaatct
caagttgttggctgtgataagagggtgcttagagggcgaaatgatgcagaagaacagagt
aatggaaaagcaggtggacaaaatagcaaaagttgtgacagcattatcagaaaggatgga
ggtaagaatgagaaggtgtctgaaatggtaaaaaaggggagtagtatagctatggacaag
aagggtgttgtcatcaaacaggtgagggttctactttctgatattctaagaaaagagcgg
gatcagaaggctgggggctcaggaagtgggaacacaggaaagaaagatctaatttcctcc
aaccataagcaaatggaagatggcagagaggcaaataatgatggagggaaagaggttagg
gaacaaatatatgatgcacagacaaatagtttgcctcatgcaacaacacaaagtgggata
atttccaaacgggggaaaggaagggctagtaagatgaaacttgagggtccaggccaagac
ttgcatattcactcgccacaaagtaatgatgatttaatcccagcgaaagataggctttcc
aagtctccccctccttcttcagaatatcttcagacacacacccaggccaacattcctctg
aagaaacggatgttccgtaattctgtggagactgactctgagcagagtatcaactctcct
gtgtcagagccatcctccaaggacctcaaaccctccacagagctgaggcagaatcttact
ctgtgttcaggaagagaaaccaaagctatcaaagtgttggaggacagaggtagaggtggg
ctgcggtctaatagtgaccctaagtctaccgtttcagagtttggggtccaatctcggaca
cagaccttcaagaggacaggaaaacaaaatgcaacgcccagaatgctgcgtcccagagtc
aatcaactggaacaagaccggccacggaggagtgcaggaaagtataaaagagggacccga
gactcagaggtactggagaatgaatctgatgaggacaaacacaaagtaggacatgatgaa
atctcactggattctaaaaaggaacatgtaaatgaaggagagaataagccagaatcacat
actgagttactgaattcactcacatcgcaaacatgcaaggaagagaacgggaaagggcag
agcctcaacttcaaaattcgttttaagagaaagaggggcaaagtgtgggagttggacaga
cctgcaggaggagaggatttgattattgaagcagaaaagtctattgattcacaacaattg
gagccttatagggccattttagattctgtgtcaatcctaaacttagaaatggagaagggt
gcccaggcagatgggaaggagactcatgacgtacgattttggaagagacgtaaagttaga
cgagacagattggggagtttgaaagatagaggtcccattttgatgaacaggcaaagtgag
gttgtagctgtagactccaaagagaaagaaaaggaacagggggagctcagcgaggtagag
ataagtgaggtgctagacgaggttatttatggagtaaagcaactaccaggagaaaagggc
catacaacttctagtgagggtatatctgtcggagtggggggactgcaatgtgactatcaa
gtcacaccaagtcctgttagaatctgtgaaaaagagaaagatattccatccttggctgaa
gatggagaacaagtgaaggatacttgtattggagtagagagtagtttggttgacagtggg
gcactgcatgaacacaaagtaaaggatgaggaccaacccttgccacggatcaaactgagg
cgtaaaatacagggtgtatgggaggtggacagccaggagttggagcagagtgaagcagag
tctgaaaaagagaagaaggaaatgacatgcgttaagccaaaagaagagtgcccttctcaa
ccgcccacctgccagaaactcaacagtgcaatcaagtgcaacactttaaaagattcctct
gctgttcttctgaaaaaagaacctccccccctcactttatctctctcaaccttgaccctt
aactctccccaacctgtgggttctgatgtgatggcctatgctcctgaaacaatgaatgat
agggccatgccaaaaatcactaataggggaggaaggggaaggggaaggggacggaaagaa
aggcagaaaacagagaccgctcgtaaggttgcaactggagagatgggaacttcttgtctt
agtcataacctgctacagatagacaacagtctttctagactctcagaagggttatgtcag
tcacaatccttagaaaaaaacataccttctgattacactgcttccacctcaaagattcca
tcccagtctcagtctcagtctccaccattcagttttccagaaagaatgctttccacagaa
tccagctttgctaattgctgtgaagatctcctcgacttccagtgtctcaatcttgaaggg
ttctatcatccacagaacatcctccaaacctctccaatagacctctgtccaatggatcca
cccagcgggccctttagtagtcccctctctcatagcccctcggatgcttggaacccagaa
acaccataccttggccctccaagcccaggaagtatcttcaatgcagaggatcagcaattt
cttaatggtcttgtgtgctccaaaaatgagtctctccctttggattgtggagttaaggat
gcttccaaagacagaggacagctcaatgcaaatttttgttttacatccctgagcagcgct
gagggcactttcatggatcgctttttgatgaaaaatcctgggatgaaattgtcaaaagaa
gattctaagacacaggccttatcttcagcagccaaaacccactactctcagaaagaatca
ttcatgtttaatacaaatactccatccatcggttcccattcccaaaataccccagtcaat
gttctcaatcagagcaccaatggtactaaggctagttctgctcattccaatttttctaag
gtccagcctcaagtgaaaactccgggtcccttccacctgatgagctcttccaacaaatct
caatctttttccacctctcagccagtaccaagttccttcaaaactgggccccagaattac
tctgtcaagtctgtccattcacctcaagtggtttctaacaagtttggctcacaattaaat
cctaatgtaggagatgcttttcgcaacacgcatgacaaaagctctagtgtgatccagagt
gtgctgaagtttcaaggagggaaaccaagtcagaatttgaatagtgccccttctaaagtt
aatattgtcgctggcaaccctaaaattgcggccaaacctcatattgccaaatctaggtac
agtgacactgacaaggtccaccagagtaacaaatgttcaggttttagcactggcggacat
aaaggtagcgtgcccagttatagcatcatttcaggaaaagatccagttcgtctcaatgca
tcaaactaccccatcaagtcaaatcttcccaatgacaaagtccatccagattatttccag
acgtccagtaaaagtacaacgacaactttggagaagccgccctctgacaaacctcaatac
actgaaaccagcttcggcagcaaaaacttctccactctcccaaggcctttctttttcccc
agccaagcacctcagagttatgggtctcctcatggcaaacatttgaatcaggacaagccc
tgtgctgctgtgcactcccagaaccctcactcttcctatgccacatcggcgtcacctgac
aaactgtgttacgattcctcagacttgaccttttccacctcgctctctccctctatgtct
cagcacaatagcccccaagtagcacacagttctccctctggatcacagacaccagctaac
aaacagcagcccccctcctcctccttctcctactcttatggtcaccaaggtccaccttac
gtggtcaactttactggtgaccactcagtcaccatgggcctgggagattacccagggtca
ccacccaccaactatacgtaccgctgcctcatggagccttcgggcacccagggaaggctg
gttctggagccatgtggaccccaactctcacactcaccatctttctctgtggggggcttt
tcagggcttaaaggccaggatgaccactgcaagagggacacacaacagcagtgccagccc
atagaccacccaccaacatctcaccatgctcccacatcctcccactccttgagtaccccg
gtctcagaccgtaagcccaaaagactgaggctagtggttactgatgggctagtggatctg
gacctccagtatacagactga

DBGET integrated database retrieval system