KEGG   Salmo salar (Atlantic salmon): 106601771Help
Entry
106601771         CDS       T04363                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00052  Galactose metabolism
sasa00500  Starch and sucrose metabolism
sasa01100  Metabolic pathways
sasa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106601771
   00500 Starch and sucrose metabolism
    106601771
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106601771
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106601771
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106601771
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106601771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 106601771
NCBI-ProteinID: XP_014049599
UniProt: A0A1S3RCW1
LinkDB All DBs
Position
ssa03
AA seq 576 aa AA seqDB search
MMPPYWSLGFHLCRWGYRSTNATREVVRCMHNANFPLDVQWNDLDYADKRRVFTFDPQRF
VDLPDMVKEFHQKGMKYILILDPGISSTSPPGTYPPFDEGQRRGVFIRNSTGQTLIGKVW
PGPTAFPDFTNPETQSWWEDCIREFHSRVPLDGLWIDMNEPASFVQGSVEGCPDSDLERP
PYVPRVVGGQLNTGTLCMSAQQNLSTHYNLHNLYGLTEASATHSALVKVRGSRPFVLSRS
SFPGIGRFSGVWTGDVRSDWEQLRYSIPAVLLFGLFGVPLVGADVCGFGGDTTEELCVRW
TQLGAFYPFMRNHNDKPNAPQEPYVFGLEAQAAMRSAVMLRYSLLPFLYTLFYHAHTSAD
TVATPLFLRFPSDPNCQTIDRQFLWGSSLLVSPVLEQGAVELAAYLPPGTWYSLHNGQPF
YSKGQYLLLPAPLDTINVHVREGHIIPQQEPGLTTSASRSNPFLLMVALSPGGWAWGDLF
WDDGDSLDTFQRGDYSYVIFIAGQSQVVSDPLRQNGALDGLVLGGLRVFGVPSPPRYVWA
NGKKVWDFSYRTDTKVLTVTSLALPMSEVFEVLWTL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctccttattggtcactggggttccacctgtgtcgctggggttaccggtccacc
aacgcaacccgagaggtggtgcgatgcatgcacaacgccaacttccccctggatgtgcag
tggaatgacctggattacgcagacaagcgtcgggtgttcacctttgacccccagcgcttt
gtggacctgccagacatggtgaaggagttccatcagaagggcatgaagtacattctcatc
ctggacccagggatcagcagcaccagcccccctggtacttacccaccctttgatgagggt
cagcggagaggggtcttcatcaggaactctacaggacagacactcatagggaaggtgtgg
cctggtccgacagcgttccctgactttaccaacccagagacacagagctggtgggaggac
tgcattcgggagttccactccagagtcccgctagatggcctgtggattgatatgaatgaa
ccagccagttttgtgcagggctctgtggaagggtgtcctgacagtgatttggagcgcccc
ccctacgtgccacgggtggttggaggacagctgaacactggtacactctgcatgtctgct
caacagaacctgtccactcactacaacctgcataacctctatgggctgacggaggctagc
gccacccacagtgccctggtgaaggtccgggggtcgcgacccttcgtgctgtcccgctcc
tccttccctggcatcggccgcttctccggagtctggacgggagatgtgaggagcgactgg
gagcagctcagatactccatccctgcggtgctgctgtttggcctgttcggggtgcccctg
gtgggggcggatgtgtgtgggttcgggggggacaccacagaggagctgtgtgtacgctgg
acccagcttggagccttctaccccttcatgaggaaccacaacgacaagcccaacgctccc
caggagccctatgtgtttgggctggaggcccaggcagccatgcgtagcgcggtgatgtta
cgttactctctcctgccgttcctctacacactcttctaccacgcacacacctccgcagac
actgtggccacgcctctcttcctccggttcccctcggaccctaactgccagaccatagac
agacagttcctgtgggggagttctctgctcgtcagcccagtgttagagcagggggcagtg
gagttggctgcctacctccccccggggacttggtacagtctgcacaatggccagccgttc
tacagtaagggtcagtacctgctcctcccagcccctctggacaccatcaatgtccatgtg
agagagggacacatcatcccacagcaggagccaggcctgactacctcagcttctcgcagt
aaccctttcctcctgatggtggcgctgtctcctgggggctgggcctggggtgacctgttc
tgggacgacggggacagtctggacaccttccagagaggagactactcctatgttatcttc
atcgctggacagtcccaggtggtgagtgaccccctgcgtcagaacggggcactggacggg
ctggtgctgggagggctgcgggtgttcggggtgccttccccaccacgctatgtatgggcc
aatggaaagaaagtgtgggatttctcttatcggactgacaccaaggttctgacggtgacc
agcctggccctgcccatgtcagaggtgtttgaagtcctgtggaccttgtga

DBGET integrated database retrieval system