KEGG   Salmo salar (Atlantic salmon): 106603858
Entry
106603858         CDS       T04363                                 

Gene name
FGF1
Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106603858 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106603858 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106603858 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106603858 (FGF1)
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106603858 (FGF1)
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   106603858 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 106603858
NCBI-ProteinID: XP_014053532
UniProt: A0A1S3RNZ0
LinkDB
Position
ssa04
AA seq 244 aa
MDLVTLGGPWMIDGVQIQTESPRQPLHHRGQFSQETHFHRRSDTQTLRDSSNSHSGRSVR
ADMLAHLGHCHVALSQPQGHLARTSRPEGLYRMTEGEITVLSMGPTTQQNYRPLIRLYCM
NGGHHLQILPDGTVAGSRDENKDDILKVKAVSVGVVAIKGHETGRYLAMDKDGNLYGSKT
LKDECYFLEKMEENHYNTYRSQKYQAKDWFLGLKRNGQPKAGQRTHIGQKAIYFLPRPVD
NTTM
NT seq 735 nt   +upstreamnt  +downstreamnt
atggatctggtgacgctgggcggcccctggatgattgacggagtacaaatacagacagag
tcacccaggcagccactgcaccacaggggccagttctcccaggagactcacttccacagg
aggtctgacacacagacgctgagagactcatccaattcacactcaggaagaagcgtcagg
gcggacatgctggctcatctggggcattgtcacgtggcgttgtcacagccacaggggcat
ttagcgcgcacctctcgtccagagggactctacagaatgacagagggagaaattactgtg
ctctccatggggccaacgacacagcaaaactacagacctctcatacggctctactgtatg
aacggaggacatcatctgcagatcctaccagatgggactgtcgcgggcagcagagatgaa
aataaagatgacatcctgaaggtaaaagcagtgagtgttggtgtggtggccatcaagggc
catgagacgggccgttatctggccatggacaaagatggtaatctctatggatcgaaaact
ctgaaggatgagtgttacttcctggagaagatggaggagaaccattacaacacgtacagg
tctcagaagtaccaggccaaagactggttcctggggctcaagaggaacgggcagcctaaa
gctggccaaaggacacacataggccagaaggccatatattttctgcctcggcctgttgac
aacaccaccatgtaa

DBGET integrated database retrieval system