KEGG   Salmo salar (Atlantic salmon): 106603909Help
Entry
106603909         CDS       T04363                                 

Definition
(RefSeq) alpha-1A adrenergic receptor-like
  KO
K04136  adrenergic receptor alpha-1B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04020  Calcium signaling pathway
sasa04080  Neuroactive ligand-receptor interaction
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    106603909
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106603909
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106603909
   04270 Vascular smooth muscle contraction
    106603909
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sasa04030]
    106603909
G protein-coupled receptors [BR:sasa04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    106603909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 106603909
NCBI-ProteinID: XP_014053608
UniProt: A0A1S3RMV7
LinkDB All DBs
Position
ssa04
AA seq 499 aa AA seqDB search
MSFDTANDANFWSNGSSELYAETPGPLSANHSNLTTANYTDTNPLDLTRAVSVGMVLGAF
ILFAIVGNILVILSVVCNRHLRIPTNYFIINLAIADLLLGTTVLPVSATLEILDYWVFGR
IFCDIWAAVDVLCCTASIMSLCVISIDRYIGVRYPLQYPCIVTEKRAILAMLGVWVLATV
ISIGPLLGWKQPPSNDDTVCPITEEPFYALFSSLGSFYIPLAVILCMYCQVYVVAKRTTK
NLEAGVMKERMDSNELTLRIHCKNAQLQEYCVTGKGQARSTLTVKLLKFSREKKAAKTLG
VVVGMFILCWLPFFLVLPIGSFNADLRPSETFFKVIFWLGYFNSCLNPIIYPCYSREFKQ
AFIRILKCRCRQKKKQKGWRACYNQRSSRLGSTNTSYLNGSQQTLSSINPSPRCVSKGTG
SRLEPGFDLNSPSPCTSLPGSPFTGQMRALPGAVYQSTSRNNRVHLVSPLAREPVHANGQ
SMNGEVEHGSIRETPDTIM
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgatactgctaatgatgccaacttctggagtaacgggtcctcggagctgtac
gcagagacaccaggaccgttgtctgcaaatcattccaacttgaccacagcgaattacaca
gacacgaatcctctggaccttaccagagccgtgtcagttggtatggttctgggcgctttc
attttgttcgcaatcgtgggcaacatactcgtaatactttccgttgtgtgcaacagacac
ctgcgtatcccaacgaactatttcattatcaacctagccattgcggacctgttgctgggt
accacagtgcttcccgtgtccgcaacactagagattctcgactactgggtattcgggagg
atcttctgtgacatatgggcagcagtggacgtgttatgttgcacggcctccatcatgagc
ctgtgcgtaatatccatagaccgttatataggcgtgcgctacccactgcagtacccctgt
atagtaacggagaaaagagccattttggccatgctcggtgtgtgggttctcgccactgtc
atctccatcggacctctactcgggtggaaacaaccaccctcaaatgatgacacagtttgc
cccatcaccgaagagcccttttacgcactcttctcctccctgggttcattttacatacct
ctggctgtcatcctgtgcatgtactgccaggtgtatgtagttgccaaacggaccactaag
aacttggaggcgggggtcatgaaagaacgcatggactcgaatgagctcacactcaggatc
cactgcaaaaacgcacagctgcaagaatactgcgtcacgggcaaaggccaggcgcggagc
acactgacggtgaaactgctcaagttctcccgggagaagaaagcagctaaaactctgggt
gtggtggtgggcatgtttattctctgctggctgccattcttcctcgtgctgcccatcggg
tcgtttaacgccgacctgcgtccctcggagacgttcttcaaggtgatcttctggctgggc
tacttcaacagctgcctgaaccccatcatctacccctgctacagccgagagttcaagcag
gccttcatacgtatcctcaagtgccgctgccgtcagaagaagaagcagaagggttggagg
gcctgctacaaccaacgttcctcccgcctgggctccaccaatacctcctacctgaacgga
agtcagcagaccctgtcctccatcaaccccagccctcgctgtgtcagcaaagggaccggc
tctcgcctagagcctgggtttgacctcaactccccatccccctgcacctctctgcctggg
agccccttcactggccagatgagggccctccctggggctgtctaccagagcaccagcaga
aacaacagagtccacctggtctctcccctggccagggagccagttcatgccaatggacag
agtatgaatggagaggtggagcatggatcaatcagggaaacacctgacacaattatgtaa

DBGET integrated database retrieval system