KEGG   Salmo salar (Atlantic salmon): 106605697Help
Entry
106605697         CDS       T04363                                 

Definition
(RefSeq) B-cell lymphoma 3 protein homolog
Organism
sasa  Salmo salar (Atlantic salmon)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3 DUF3447
Motif
Other DBs
NCBI-GeneID: 106605697
NCBI-ProteinID: XP_014057067
UniProt: A0A1S3RYQ2
LinkDB All DBs
Position
ssa05
AA seq 689 aa AA seqDB search
MPRTMTMNGHQTQTTVPLDLRTTKRECGNGAEGTPTSKGRSVLVRVPYPIAPLTEDGCPN
GNPSHTVEPLAHRCGSSLIRPPVNTGNPAVLEKKHSPAVTSHTPFTPNPGERSTTDTRTQ
DISSSRLPFRKRQFPTEWETPEQSRTPPGREERLSPYKNKDLCCRPSPPKIVLKSYDDES
IGSLASVSHRQLSVASGFDNGHQSVDPVRSMQALRPYYPYPGYPFYSWPSRSPLVVNVPV
SHLQSSLYPTGHTEHLLADVAQATCQDDDGDTALHIAVVQGQEAQIQRMILLLGLVHTDL
DIYNNLRQTPLHLAVITHQAQLVGALLHAGADPGALDRNGQTAVHLCCEHGQQACLSVVL
SHPSILTCLEVRNYEGLTPLHLAVQGGHKELVRMLLDAGADINAMQDIKSGHSPLIHAVE
NHNMGMVHFLIENDCNVNVQSYSGNTALHSACGRGQVDTARLLLKNRADSSVKNYHNDTP
AMVAKNKKVIDVLRGKGSRNQQPKAQQCVPASPHRSTPHSQNRGSPSPSLGLSPLATPTA
SPLHRSASHSPRAPPTPSPHSQSAESLSGRQSPMKTQESEQLPVRLGSDRMTAVDISLAQ
RRTYSLTHSYPPAMHQSPITDAQIGHLLTYYSPGVQRPLYPEPPFILLHTNIPYPATVST
ASQMTPGQSRPSSHCSDQSDVSITSKGNS
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggaccatgaccatgaacggtcaccagactcaaaccacagtaccactggatttg
cgcaccaccaagagggagtgtgggaacggtgccgaagggactcccaccagcaaaggtcgc
tccgttctggtgagagtgccgtatcccatcgccccactcacggaggatggctgtccaaac
ggaaatcccagccacactgtggagccgctggcgcatcgttgtggatcatcgttgattaga
cctcctgtgaacacgggaaacccggcagttctggagaaaaaacactccccagctgtaact
tctcacacgccattcactccgaaccctggtgagcgcagcacaacagacacacgaacacag
gacatatcgtcctcgaggcttccttttagaaaacgtcaatttcctaccgaatgggagacg
ccggaacagtcacgtaccccacccgggagagaggagcgcttatccccctacaaaaacaaa
gacttgtgctgcagaccgagtcctccaaagattgtattaaagagctacgacgatgagagc
attggttccctggcatcggtctcacacagacaattgtccgtcgccagcgggtttgacaat
ggacaccaaagcgtcgatccggttcgttcaatgcaagcactccgtccttactatccctat
ccagggtacccattctactcctggcccagcaggtcaccgctggttgtgaacgtgcctgtc
tctcacctccagtcctctctttacccgacgggacacaccgaacacctgctggcagatgtt
gcccaggcaacgtgccaagatgacgacggcgacacggctcttcacatagcagtggtgcag
gggcaggaagctcagatccaaagaatgatccttctcctgggactggttcacacagacctg
gacatctacaacaacctaagacagacccctcttcatctggctgtgattacccatcaggcc
cagctggtgggggcgttgctgcatgcgggtgctgacccgggggctctggaccgtaacggt
cagacagcggtccacctctgctgtgaacacggccagcaggcctgcctctctgtagtcctt
tcccacccctccatcttgacttgcctggaggtcaggaactatgagggactcacccctctc
cacctagctgtacagggtggacacaaggagctggtcagaatgctgctggatgctggggcg
gacatcaacgctatgcaggacatcaagagtggccacagtcctctcatacacgcagtagag
aaccacaatatgggcatggtgcacttcctcatagagaatgactgtaatgtgaatgtccag
tcgtacagtgggaacacggccctgcacagtgcctgtgggcgaggccaggtagacacagcc
aggctgctactgaagaacagagccgacagcagtgtgaagaactaccacaatgacacccct
gcgatggtggccaagaacaagaaggtaatagatgtactacgagggaagggctccagaaac
cagcagcccaaagctcagcagtgtgtaccagcctcaccacacaggagcacaccccactca
cagaacagaggttctccatctcccagcctaggcctttcaccattggccactcccacagct
tcgcctcttcaccgcagcgcatcccattcccctagggcacctcccactccctctcctcac
agccaatcagcagagagcctgtcaggccgccagtctccaatgaagacccaggagagcgag
cagctgccggtgaggctaggttccgacaggatgactgcagtggacatcagcctggcccag
agaaggacgtactcactgacccacagctaccctccagcaatgcaccagtcccccatcact
gatgctcaaataggacatttactaacctactactcccctggagtccagagacctctttat
ccagagcctccctttatcctcctccacaccaacatcccttacccagccactgtctctact
gcctcccaaatgacccctggccaatcccggccctccagccactgcagcgaccaatcagat
gtctccatcacgagcaaaggtaacagttga

DBGET integrated database retrieval system