KEGG   Salmo salar (Atlantic salmon): 106606173
Entry
106606173         CDS       T04363                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04060  Cytokine-cytokine receptor interaction
sasa04068  FoxO signaling pathway
sasa04144  Endocytosis
sasa04218  Cellular senescence
sasa04350  TGF-beta signaling pathway
sasa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106606173
   04350 TGF-beta signaling pathway
    106606173
   04068 FoxO signaling pathway
    106606173
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106606173
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106606173
  09143 Cell growth and death
   04218 Cellular senescence
    106606173
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106606173
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106606173
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     106606173
Protein kinases [BR:sasa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   106606173
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal
Other DBs
NCBI-GeneID: 106606173
NCBI-ProteinID: XP_014057779
UniProt: A0A1S3S0V2
LinkDB
Position
ssa05
AA seq 581 aa
MERRGFSLLCWGTIASLFISVLEPSAVDGMFQPPFSLKKLCMFCDVESSSCNGTGSCLSN
CSITSICPLEQEVCIAIWRKNDGNYSIETLCHDPSQPLYGVVLDDYNSSTCTMKEKKSSG
GPLFICSCTGEECNNNLEFAPVGPTIESPVVSIILISLLPLLVLAVVVITMLYWYRVQRH
RKLTEEEWDSKKPKRKGKGLDCSIMMDDDGSDSSSTHANNLNHNTEPLPIELDLQVGKGR
FAEVYKAKLRQPGSSSDQFETVAVKIFPEEEYASWKNEKDIFSDIDLRHDNVLHFLTAEE
RKMSKQYWLITAFHPRGNLQEYLTRNLVTWEDLRGLGGSLACGVAHLHSDHTASGRPKVP
IVHRDLKSSNILVKQDLTCCLCDFGLGLRLDNTLTVDDLANSGQVGTARYMAPEVLESRL
NLENIESFKQTDVYSMALVLWEITSRCHAIGEVKDYEPPYGCKVQMHPGVESMKDHLLRD
RGRPEIPDSWINHQGIAIVCGSIEECWDHDPEARLTAQCVAERFSEIEDEMEKLSSRSSS
DEKIPAEELKIPTLPEEERQMIAGQIDEVKVAVESSVSDEK
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggagcgacgtggattttccttactttgctggggcacgatagcttccctgtttatatcc
gttctggaaccgagcgcagttgatgggatgttccagccgcccttcagtctgaagaagttg
tgtatgttctgtgacgtggagtcttcatcctgcaacggaacaggaagctgcctttctaac
tgctccatcacctccatctgtcctctggagcaggaagtctgcatcgccatctggaggaag
aatgacggtaactacagcattgagactctgtgtcatgacccctcccagcctctgtacggt
gtggtgctggatgactacaacagttctacatgtaccatgaaggagaagaagagctctgga
ggaccgttgttcatctgttcctgtactggggaggagtgtaacaataacctggaattcgct
cccgttggcccgaccatcgagtccccggtggtatccatcatcctgatcagcctgttaccc
ttactggttctagcggtagtagtcatcactatgctctattggtaccgagtccaacgccat
cgcaaactcaccgaggaagagtgggacagcaagaagcccaaacgcaagggcaaaggtctg
gactgcagcatcatgatggacgacgatggatcagacagcagctctacgcacgccaacaac
ctcaaccacaacactgagcccctacccatcgagctggacctgcaggtgggtaaggggcgc
ttcgctgaggtgtacaaggccaagctgaggcagcccggctcctcatcggaccagtttgag
acggtggccgtgaagatcttccctgaggaggagtacgcatcgtggaagaacgagaaggac
atcttctctgacatcgaccttcgccacgacaacgtcctccacttcctcacagcagaggag
agaaagatgtcgaagcagtactggctgatcacagccttccacccccggggaaaccttcag
gagtacctgacccgtaacctggtcacctgggaggatctacgcgggctgggggggtccctg
gcctgcggggtggcacaccttcacagtgaccacacggccagcgggcggcccaaggtgccc
atcgtacaccgcgacctgaagagctctaacatcctggtgaaacaggatctgacctgttgt
ctgtgtgactttggactggggctcagactggataacaccctgacagtggatgatctagct
aacagcggacaggtgggcacagccaggtacatggctcctgaagtgctggagtccaggctg
aatctggagaacattgaatcgttcaagcagacagatgtctattctatggctctggtgttg
tgggagatcacctcccgctgtcatgccatcggagaggtgaaggactatgagcctccatat
ggctgtaaagttcagatgcaccctggtgtggagagcatgaaggatcacctcctcagagac
agaggaagacctgagatcccagacagctggatcaaccaccagggcatagccatcgtgtgt
ggttccatagaggagtgttgggaccacgacccggaggccaggctcacagcccagtgtgtt
gccgaacgcttcagcgagatagaagacgagatggaaaaactgtccagtcgcagcagctcc
gatgagaagataccagcggaggaactgaagataccgacgctacctgaagaagaacgacag
atgatagcaggacagatagacgaggtgaaagtagcggtggagagctctgtgagcgatgag
aagtga

DBGET integrated database retrieval system