KEGG   Salmo salar (Atlantic salmon): 106606415Help
Entry
106606415         CDS       T04363                                 

Gene name
gys1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00500  Starch and sucrose metabolism
sasa01100  Metabolic pathways
sasa04910  Insulin signaling pathway
Module
sasa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106606415 (gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106606415 (gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sasa01003]
    106606415 (gys1)
Enzymes [BR:sasa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     106606415 (gys1)
Glycosyltransferases [BR:sasa01003]
 Polysaccharide
  Storage polysaccharide
   106606415 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 106606415
NCBI-ProteinID: XP_014058064
UniProt: A0A1S3S1L2
LinkDB All DBs
Position
ssa06
AA seq 712 aa AA seqDB search
MPLARSLSITSLSGLEEWDEEFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTAEEWGE
NYFLVGPYVESNVRTQVELIEPTNPALKRAIDKMNSSGCKVYFGRWLIEGSPYVVLIDVA
FTAWNLDKWKKELWDNFSIGVPWFDREANDAVLFGFLTAWLLGEYAAQCEEPPHILAHFH
EWLAGLGLALCRQRQLPVATIFTTHATLLGRYLCAGSVDFYNNLADFNVDKEAGDRQIYH
RYCLERTAARCAHVFTTVSQITAVEAEHLLKRKPDIITPNGLNVKKFSAMHEFQNLHAQS
KNRIQEFIRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDV
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVSKML
DKDDFTMMKRAIFATQRQCQPPICTHNMLEDSNDPILTCIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRYRGVDESCNQLTSYLFQFCQQSRRARIIQRNRTERLSDLLDWRY
LGRYYISARHMALAKAFPDTYFYQPHDSETAQGFRYPRPASVPPSPSLSRHSSPRQSEAE
EDDDRYDEDAEAEKDRLNIRQPLTLPSKKGPALPYTLPGANGEKNGAASVKN
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgcctctggctcgcagcctgtccatcacctccctgtcggggttggaggagtgggatgag
gagtttgacctggaggacgctgtcctcttcgagatcgcatgggaggttgccaacaaagtc
ggtgggatttacacagtgatccagaccaaagcccgtctgacagcagaggaatggggagaa
aactatttcctggttggtccgtacgtggagagtaacgtccgcacccaggtggagctgatc
gagcccaccaaccctgcccttaagagagccatagacaagatgaattccagtggatgtaag
gtgtactttggtcgttggctgattgagggcagtccatacgtggtgctgatagatgtggcg
ttcacggcctggaacctggataagtggaaaaaagagttgtgggacaacttctccatcggg
gtgccctggttcgaccgcgaggccaacgacgccgtcctctttggcttcttgaccgcctgg
ttactaggagagtatgcagcgcagtgtgaggagcctccccatatcctggcccatttccat
gagtggctggcaggcctgggcctggctctatgccgacagagacagttgcccgtggcaaca
atcttcaccacccacgccaccctgctgggacgctacctatgtgccggcagcgtggacttc
tacaacaaccttgccgatttcaacgtggataaggaggcgggggatagacagatctaccat
cggtattgtctggagcggacagcggcgcgctgcgctcatgtcttcaccaccgtctctcag
atcacagccgttgaggcagagcacctgctgaagaggaaaccagacataatcacccctaac
gggctgaatgtgaagaagttctctgccatgcatgagttccagaacctgcacgcccagagc
aagaaccgtatccaggagttcatcagaggtcacttctatgggcacctggacttcaacctg
gacaagtgtctgttcctgttcatcgctgggaggtatgagttcagcaacaaaggggcggat
atcttcttggaggctttggccagactcaactatctactgagagtcaaccacagcgatgtg
actgtcgttgcgttcttcatcatgcctgcgcggaccaacaacttcaacgtggagacgctg
aaaggccaagcagtcaggaagcagctctgggatacagctcaaactgtgaaagaacgcttc
ggaaagaaactttatgaatcactgctggttgggcagttgccggacgtgtccaagatgctg
gacaaggatgacttcaccatgatgaagcgtgccatctttgccacccagaggcagtgccag
cctcccatctgtacccacaacatgctggaggacagcaacgaccccatcctcacttgcatt
cgccggatcggcctgttcaacagctctgccgaccgtgtcaaggtgatcttccacccagag
ttcctctcctccacctctcccctccttcccatggattatgaagagtttgtaagaggctgc
catcttggagtgttcccctcttactatgaaccatggggatatacaccagctgagtgtaca
gtcatggggatcccctcaatctctaccaacctctctgggtttggctgcttcatggaggaa
cacatagctgatccctcagcatacggaatctacatccttgatcgccggtacagaggggtt
gatgagtcatgtaaccagctcacatcgtacctgttccagttctgccagcagagccggcgc
gccaggatcatccagcggaaccgcaccgagcgcctgagtgaccttctggactggagatat
ctgggcaggtattacatatcagctcgtcacatggccctggctaaagccttcccggatacc
tacttctaccaacctcatgactctgagactgcccaaggtttccgttaccctagaccggcc
tctgtgcccccatctccgtctctgtcacgccactcctccccccgccaaagcgaggcagaa
gaagatgatgaccgctatgatgaagatgcagaggcagagaaagaccgcttgaacatccgc
cagcccttgaccctgcctagtaaaaagggtcccgccttgccttacaccctgccaggtgcc
aacggagagaaaaacggcgccgccagcgtgaaaaactga

DBGET integrated database retrieval system