KEGG   Salmo salar (Atlantic salmon): 106607297
Entry
106607297         CDS       T04363                                 

Definition
(RefSeq) signal transducer and activator of transcription 3-like
  KO
K04692  signal transducer and activator of transcription 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04217  Necroptosis
sasa04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106607297
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106607297
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106607297
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106607297
Transcription factors [BR:sasa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    106607297
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 AP1AR PRKCSH-like
Other DBs
NCBI-GeneID: 106607297
NCBI-ProteinID: XP_014059591
UniProt: A0A1S3S5G7
LinkDB
Position
ssa06
AA seq 807 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
TAAQDGTASHPSGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QSDNPPNSSPICSELSQDMNGNSQAAATRQKMSQLEQMLSALDQLRRQIVTEMAGLLSAM
DFVQKNLTDDELADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQ
QKVSYKGDPIIQHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNK
VRLLVKFPELNYQLKIKVIIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEF
KHLTLREQRCGNGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNIC
QMPNAWASILWYNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTL
AEKLLGPCVNYSGCQITWAKFCKENMVGKGFSFWVWLDNIIDLVKKYILALWNEGYILGF
ISKERERAILSPKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSM
SFAEIIMGYKIMDATNILVSPLVYLFPEIPKEDAFGKYCRPEAAPEAELGDPCSTIQPYL
KTKFICVTPCPSVFMDFPDSELLGNGIFPGTNSGNTSDLFPMSPRTLDSLMHNEAEANPG
PLALLLSVFPDSLTLDMELSSDVASPM
NT seq 2424 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttgcagcagctggagaccaggtatctggagcagctgtaccac
ctgtacagcgacagcttccccatggagctccggcagttcctcgccccctggatcgaaagc
caggactgggcgtacgcagcgaacaaggagtcccacgccacgctggtgttccacaacctg
ctgggggagattgaccagcagtacagccgcttcctgcaggagaacaacgtgctctaccag
cacaacctgcggcgcattaagcagcacctgcagtccaagtacctggagaaacctatggag
atcgcccgcattgtagcccgctgcctctgggaggagcagaggctgctgcagactgccacc
accgccgcacaggacggaacggcgtctcacccgtctggcactgtggtgacggagaaacaa
cagatcctggagcacaacctgcaggacatcaggaagagggtgcaggatatggaacaaaag
atgaagatgcttgagaatctccaggatgattttgacttcaactacaagacccttaaaagt
cagagtgataacccacccaactcctctcctatttgctcagagttgtcccaggacatgaat
gggaacagccaggcggcagccaccaggcagaagatgtctcagctggaacagatgctgagt
gctctggaccagctcaggaggcaaatcgtgactgagatggcagggctgctgtcagccatg
gactttgtccagaagaacctgacagatgacgagctggctgactggaagaggaggcagcag
attgcctgcatcggaggaccacccaacatttgtctggaccgcttggagacatggattact
tccctggctgagtctcagctgcagatccgccagcagatcaagaagctggaggagctccag
cagaaggtgtcctataagggagaccccatcatccagcaccggcccgctctggaggagaag
atcgtggacttgttcaggaacctcatgaagagtgcgttcgtggtggagaggcagccttgt
atgcccatgcatccagacagaccgctggtcatcaagaccggtgtgcagttcaccaacaaa
gtcagattactggtgaagtttccagaattgaattaccagctgaagatcaaagttattatt
gacaaggaatctggggacgtggctgccattcgagggtcccgaaagttcaacatcctaggt
accaacaccaaggtgatgaacatggaggagtccaacaacggcagtctgtcagcagagttc
aaacacctgaccctgagggaacagaggtgtggcaatggtggccggaccaacagtgatgcc
tccctgatcgttacagaggagctccacctcatcacctttgagacagaggtctaccaccag
ggcttgaagatcgacctggagacccattctctaccagtggtggtcatctccaacatctgc
cagatgcccaacgcctgggcctccatcctgtggtacaacatgctgaccaaccaccccaag
aatgtgaatttcttcaccaagcctccggtggggacgtgggatcaggtagcggaggtgctg
agctggcagttctcctccaccactaagagaggcctgaccatcgagcagctcaccaccctg
gctgagaaactactagggccgtgtgtgaactactctggatgccagatcacctgggccaag
ttctgcaaagagaacatggtgggtaaaggcttctctttctgggtatggctggacaacatc
attgacctggtcaagaagtacatcctggctttgtggaatgaagggtatattctgggtttc
atcagtaaggagagggagagggccatcctgagccctaagcctcctggcaccttcctgctg
cgcttcagtgagagcagtaaggagggaggcatcaccttcacctgggtggagaaggacatc
agtgggaagactcagatccagtcggtggagccttacaccaagcagcagctcaacagcatg
tcctttgcggagatcattatgggatacaagatcatggacgccaccaacatcctggtgtct
ccgctggtctacctcttcccagagatccccaaggaggacgcctttgggaagtactgccga
ccggaagctgctccagaggctgaactaggagacccgtgtagtaccattcaaccatactta
aagacaaagttcatctgtgtgaccccgtgcccttccgtgttcatggactttccggacagc
gagctgcttgggaacgggatattccctggcaccaactctggtaacaccagtgatctgttt
cccatgtcccctcgcaccctggactctctgatgcacaacgaggctgaggccaaccctggc
ccgctggccctcttgctttctgtcttcccagactccctcactctggacatggagttgagt
tctgacgtggcgtcacccatgtga

DBGET integrated database retrieval system