KEGG   Salmo salar (Atlantic salmon): 106607326Help
Entry
106607326         CDS       T04363                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04210  Apoptosis
sasa04625  C-type lectin receptor signaling pathway
sasa04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106607326
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106607326
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106607326
   04672 Intestinal immune network for IgA production
    106607326
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106607326
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     106607326
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  Other
   106607326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 106607326
NCBI-ProteinID: XP_014059660
UniProt: A0A1S3S5P5
LinkDB All DBs
Position
ssa06
AA seq 875 aa AA seqDB search
MAVRRRIFNSTRPFSGSPQIELKGSYPSLPSPEDRTSDEEGKESKGDFMPSLKPRIIKVL
TIGTAEQVGEAGPLNYQKNSFIAQAECETQDSQQFSPSCSERSFVASPNCLINRDSSEHN
NVACSNAASNQDKPGSPAHRSPRKKPRKKQKRKEKKEEQRETGKQRQRRRVPSGVPEQET
QTGSSPQLIQTQDASEHQSNISTSYSSSIPSLEAHDTRRPYPLQDCNRDPSHSHLYWGPQ
VFSPPSNLSTYGQESDSDSPLSSVGNCSLALAGLRGSVSQEDRCYAGPFCKDFCKDVERD
VREKEGEVSETDTNEGLIFNVNIQPVNHEYKEGKDYSLCKSINTGSYGEVHSVQDNRTHF
KFGAKKILLKSFSSEEVGTWSALKSPRVVELFGVIREGPYVVLFMDLKAGSVGQLIKERA
RLPEDLALHYHCQVLEALEHLLKRRVLHLDIKADNVLLSEDGRDTFLCDFGHSERMDIGG
QSLSASQGDLKGTETHMAPEIVKGETRGAKADVWSSCCMLLHMLNGCQPWTRYYSRPLYF
KIANEPPPLREIPPDCSPFTADVIKVGLQKEPTKRASASELKERAARALREVGGLSSPIR
GSYKEPLQIDDSPSQSSQPLPPFSRDTCSEESPELWLESMNPGSRELNNDEEEEGSEADT
EETASSPDSPRSLLTQLHEWQNPKMADVTSNVSELELRKLEREFYLTSLSQLHSAETQEQ
LLSCLSSSDCYSNRDLWDRKDSGRWSISPGDDLSSGVFSYNSQPDGQILSMDWLVHQSHL
SPPRCFEGVDVCITDVNGQSIRIREKRRVKVGHIATGISDQISERVFTMETQEREPVAHD
EEVQDSGLLLRCVPAPDYCQAWRWRVKEGVLETRN
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaggcgaaggatctttaactcgaccagaccattctcagggtcaccccaaata
gagctgaaggggtcttacccaagccttcccagcccagaagacaggacgagtgacgaggag
gggaaggagagcaaaggggacttcatgcctagtttaaaacccagaataattaaagtccta
acgataggcacagcagaacaagtgggtgaagcaggtccactgaactatcagaagaactcg
ttcatagcccaggctgaatgtgaaacccaagactcccagcagttcagcccttcctgctcc
gaacgctcctttgtcgcgtcccccaactgcttaatcaaccgggactcatcagagcacaac
aatgtggcgtgttccaacgcagcctccaaccaggacaaaccaggctccccggcccaccgc
tcacccaggaagaagccaaggaagaaacagaagaggaaggagaagaaagaggagcagagg
gagacagggaagcagagacagagacgtagagtaccttctggtgtccctgagcaggagacc
cagactggcagttctcctcaactgatccagacccaggacgcttcagagcaccaaagtaac
atcagcacttcctacagtagcagtatcccgagtttagaggcacatgacacaaggcgccct
taccccctccaggactgcaacagggaccccagccattcccacctctactggggcccccag
gtgtttagccccccctccaacctctccacctatgggcaggagagtgactcagactctcct
ctcagcagtgtgggaaactgttcgttggccctggcagggctcaggggcagtgtcagtcag
gaggaccgatgctacgcaggtcccttctgcaaagacttctgcaaagacgtggaaagggat
gtcagggagaaggagggagaagtctcagagactgacaccaacgagggcctgatcttcaat
gtgaatattcagcctgtgaatcatgagtacaaggaggggaaggactacagcctctgcaag
tctatcaacacagggtcatacggggaagtgcacagtgtgcaagacaacagaacacacttc
aaatttggtgccaaaaagattctcctgaagagttttagtagtgaggaagtgggtacgtgg
agtgccctgaagtctcctcgcgtggtggaactcttcggagtgatcagagaggggccctac
gtcgtcctcttcatggacctcaaggctggctctgtgggtcagcttattaaagagagggct
cggctacctgaggacctggccctgcactaccactgtcaggtcctggaggcgctggaacac
ctgctgaagagacgagtgctgcatctggacataaaggcggacaatgtgttgctgtcagag
gatgggagggacacttttctgtgtgactttggacactcggagagaatggacatcggtgga
cagagcctaagtgcatcccaaggagatctgaaggggacagagacacacatggccccggag
attgtgaaaggggaaacccgcggagccaaagcagacgtgtggagcagctgctgcatgtta
ctgcacatgctcaacggctgccagccctggacacgatactactcccgcccactgtacttc
aagatagccaatgagccaccgcctctgagggagatcccgcccgattgcagtcccttcact
gctgatgtcataaaggtgggactacagaaggagccaaccaagagggcctccgcctcggag
ctcaaggaaagagcagccagagctctgagagaagtgggaggactcagcagccccatcaga
gggtcctataaggagcccctacagatagatgacagccccagccagtctagccagcccttg
cctcccttcagcagagacacctgctctgaggagagtcctgagctatggctggaatccatg
aacccagggagcagggagctgaacaatgatgaggaagaggaaggcagtgaggcagacact
gaggagacagcctcatctccagactcacctcgctctctactgacacaactccatgaatgg
caaaatcccaagatggccgatgtcacctccaatgtgtctgagcttgaactgcgcaaactg
gagagagagttctacctgaccagtctgtctcagctgcactcagcagaaacccaggagcag
ctactgtcctgcctgagcagcagtgactgttactccaacagggacttatgggacagaaag
gactctggccgttggtccatcagcccaggtgatgacctcagctctggcgtgttctcctac
aacagccaaccggacggacagattctcagtatggactggctggttcaccaaagccacctg
tctccaccccgatgctttgagggagttgacgtctgcatcacggacgtaaatgggcaaagc
atccggatccgagagaaacgcagggtgaaggtgggacacatcgccacggggatcagcgac
cagatctctgagagggtgttcaccatggagactcaggagcgggagccagtggcccacgat
gaggaggtgcaggactctggcctcctgctccgctgtgtccctgctcctgactactgccag
gcctggagatggagggtcaaggagggggtgctggagactcgtaactga

DBGET integrated database retrieval system