KEGG   Salmo salar (Atlantic salmon): 106607897
Entry
106607897         CDS       T04363                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00230  Purine metabolism
sasa01100  Metabolic pathways
sasa04020  Calcium signaling pathway
sasa04114  Oocyte meiosis
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04270  Vascular smooth muscle contraction
sasa04371  Apelin signaling pathway
sasa04540  Gap junction
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106607897
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106607897
   04020 Calcium signaling pathway
    106607897
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106607897
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106607897
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106607897
   04914 Progesterone-mediated oocyte maturation
    106607897
   04916 Melanogenesis
    106607897
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106607897
   04270 Vascular smooth muscle contraction
    106607897
Enzymes [BR:sasa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     106607897
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Calmodulin_bind fn3_4
Other DBs
NCBI-GeneID: 106607897
NCBI-ProteinID: XP_014060851
UniProt: A0A1S3S940
LinkDB
Position
ssa06
AA seq 1106 aa
MSINRVYTDTEQSAEDSGECSVPVSSDNGHGAGRTHEVTVRNTGCCVCLPRIMRLTFAPE
SLERLYQVYFRRQRQETLLVLVVFAALFNCYVIVMCAVVYTTDKRAMIVVAAVGLAADIV
LYTLCRLRKLPAAPVVRGVIPYVLWLMIAVHVLCYLGLNYQLSPQACDTAGWQAFFSFSC
FLTLPLTLVPLLLLTALSCGVHTLVLGVTIAQRHQDSLQGTILLRQLLANWVLYLFAVTV
GVISYYMADRKYRTAFLEARQSLEVKLTLEEQSTQQEELLLSILPKHIAEEMLEGMKKQA
NQNEVQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAQHH
QLRIKILGDCYYCICGLPDYRDDHAACSIMMGLAMVEAISYVREKTKTEVDMRVGVHTGT
VLGGVLGQRRWQFDVWSTDVTVANKMESGGIPGRVHISQSTMECLHGEFDLEPGNGGERC
EYLLEKGIDTYLVLFSKETTQVNGLNMVNRNSPQLINTTETNGSVGSVRGTPTERKQEAK
TQVTSPQRQIKKKVDARESEQELNRLLHLELLERENEEPAKERRTNPVSLQFVDGELEGR
YSAEKERQSGVAFCCSCLVLFFTAGMEVLIDPMLMVNYVTLAIGEGLLLILTICSMAAVF
PRMFSKRLVSFSMWIDRTRWARNTWAIAAIFVLTMAEIADMLSCVQPPFLFLNTSAGLSR
ESLGDGGCAENPKHYSYMAVLSLVATTMLVQVSHLVKLGLMLLVIVATGAVNIYSWRDIY
DLYDFIRFTSYRMSVVPSKYLMTVMIMIMMICFYYFARHVERQSRKLFLWKIEVHDQKER
VFEMRRWNEALVTNMLPEHVAKHFLGSKKRDEELYSQSYDEIGVMFASIPNFSDFYTEEG
INNGGIECLRILNEIISDFDSLLDRNEFRFITKIKTIGSTYMAASGVTPESNTNGYCNRP
IEEQSLLERWQHLADLADFALAMKVTLTKLNDQSFNNFMLRIGLNKGSVLAGVIGARKPH
YDIWGNTVNVASRMESTGVMGNIQVVEDCYDILKEYGFRFVRRGPIFVKGKGELLTFFMK
GKDKTSSNGTGPTTTTTLPHQVVDHS
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgtctataaaccgggtttacacagacacggagcagtctgcagaggattctggagaatgt
tcggtcccagtctcgtcggacaacgggcacggagcaggtcgtacgcacgaggtgaccgtg
cgcaacaccggctgctgcgtgtgcctgccgcgcatcatgcgcctcacctttgcgcccgag
tccctcgagcggctctaccaggtctacttccgacggcagcgacaggagactcttctcgtg
ctggtggtgtttgcggcgcttttcaactgctatgtcattgtcatgtgcgcagtggtgtac
acgacagacaaacgtgcaatgatcgtggtcgcggcagttggacttgctgcggatattgta
ctctacacgctttgccgactgcgcaagctccccgcggcgcctgttgtgcgcggtgtgata
ccatacgtactctggctgatgatagccgtgcacgtgctgtgctacctggggctgaactac
cagctttccccccaggcctgtgacacagcgggctggcaggccttcttcagtttctcatgc
ttcctgacgctgcccctgaccctggtccctctcctgctgctcactgctctgtcctgtggg
gtccataccctggtgctgggggtcaccatcgcccaaaggcaccaggacagcctgcaggga
accatactgctcagacagctcctggctaactgggtgttgtacctgtttgcggtcactgtg
ggcgtgatatcatactacatggccgacaggaagtaccgaacggccttcctggaggcgcgc
cagtccctggaggtcaaactcaccctggaggagcagagcacccagcaggaggagttgttg
ctgtccatcctgcccaaacacatagcagaagagatgctggagggcatgaagaaacaggct
aaccagaacgaagtgcagcagttcaacaccatgtacatgtaccgtcatgagaacgtcagt
atcctatttgctgatatagtgggttttacccagctctcctcagcgtgtagtgcacaagag
ctggtcaagctgctcaacgaactgttcgcccgctttgacaagctagctgctcaacaccac
cagttgcgtatcaagatcctgggagactgttactactgtatctgtggcttgcctgattac
cgtgatgaccacgcagcctgttccatcatgatgggcctggccatggtggaggccatctcg
tatgtgcgtgagaagactaagacagaggttgacatgcgtgtgggggtgcacacaggcact
gtgctgggaggggtgctgggacagaggaggtggcagtttgatgtctggtccactgacgtc
actgtggccaacaagatggagtcaggagggatacctgggcgtgtccacatctcccagagc
accatggagtgtctgcatggagagtttgacctggagccagggaacggaggggagaggtgt
gagtacctgctggagaaaggcatagatacctacctggtgctgttctccaaggaaaccacc
caggtcaacggactcaacatggtaaatagaaactctccccagttgattaacaccacagag
accaatgggagcgtcggttcggtccgaggcacgcccacagagcgcaaacaggaagcaaaa
acacaggtgacgagccctcagcgtcaaataaaaaagaaagtggatgccagggagagtgaa
caggaactgaacagactactgcacctggagctgctggagagagagaacgaagagcctgcg
aaggagcgtcggaccaaccctgtgtccctgcagtttgtggatggggagttggaggggcgt
tactctgcagagaaggaaagacagagtggtgtagctttctgctgcagctgcctggtcctc
tttttcactgcaggcatggaggtcctcatagacccaatgctgatggtgaactatgtgacc
ctggcgattggagaggggttgctgctcattctcactatctgctccatggctgccgtcttc
cctcgtatgttctcgaagaggctcgtgtcgttctcaatgtggatcgatcgaacccgttgg
gcacggaacacctgggccatagcagccatctttgttttaaccatggccgagattgccgat
atgctgagctgtgtccagcctcccttcctgttcctcaacaccagtgctggcctcagcagg
gagtcgctaggtgacggaggttgcgcagaaaaccctaaacactacagctatatggcggtg
ctgtcgcttgtggcgaccacaatgctggtgcaggtgagccacctggtcaagctggggctc
atgctgctggtcattgtggcaacgggcgccgtcaacatctacagctggagggatatctac
gacctgtatgacttcatacgattcaccagctacaggatgtctgtagtcccttccaagtac
ctgatgacagtgatgatcatgatcatgatgatctgcttctactactttgccagacatgtg
gagaggcagtcgcggaagcttttcctgtggaagattgaggtgcatgaccagaaggagagg
gtgtttgaaatgaggcgctggaatgaagcgctggtcaccaacatgctgcctgaacatgta
gccaaacacttcctgggttctaagaagagagacgaggagctgtacagccagtcatatgat
gagataggagtgatgtttgcctccatccccaacttctcagacttctacacagaggagggc
atcaacaatgggggcatagagtgtctgaggatcctcaatgagattatctctgactttgac
agtctgttggacaggaatgagttccgcttcatcactaagattaagactataggaagcacc
tacatggctgcgtctggagtcacacccgagagcaacaccaacggatactgcaaccgcccg
atagaggaacagtcattgttagaacgttggcagcacctagctgacctggcagactttgct
ctggccatgaaggtcactctcaccaaactcaacgaccagtccttcaacaacttcatgcta
cgcatcggtctgaataagggctcggttttagctggagtgattggtgctcgtaaacctcat
tatgacatctggggcaacacagtcaacgtagccagcagaatggagtctacaggggtgatg
ggcaacatccaggtggtggaggactgttatgacatcctaaaggagtacggattccgcttc
gtcaggagaggccccatctttgtcaaggggaagggggagctactaaccttcttcatgaaa
gggaaagacaaaactagtagcaacggcactggtcccaccactactactacccttcctcac
caagtagtggaccattcctga

DBGET integrated database retrieval system