KEGG   Salmo salar (Atlantic salmon): 106608895
Entry
106608895         CDS       T04363                                 

Gene name
epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106608895 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106608895 (epo)
Cytokines and growth factors [BR:sasa04052]
 Cytokines
  CSF and other factors
   106608895 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 106608895
NCBI-ProteinID: XP_014062572
UniProt: A0A1S3SE04
LinkDB
Position
ssa07
AA seq 186 aa
MFHNSSRGLFTFLLMLLEWTKPGISSPLRPICDLRVLKHFIEEARDAEAAMLACKEGRGL
PEPVTVPQTKVDINVWERKNALEQAQEVQSGLWLLNQAIGSLRTSVTNTALHSHIDNSLR
NIFSIGQVLRSLNIQEYTPPAGGVAGGEETWRVSSASELLQVHVNFLRGKVHLLLSNAPI
CNQGSS
NT seq 561 nt   +upstreamnt  +downstreamnt
atgttccacaattcaagtagaggactctttacctttctgctgatgctgttggagtggacc
aaaccagggatatctagccccctgcgtccgatctgtgacctgagggtcctaaaacacttc
attgaagaggccagagatgctgaggcagccatgctggcatgtaaagaaggacgtggtctt
ccagagcctgtcactgttccccaaaccaaagtagacatcaatgtctgggagaggaaaaat
gcactggagcaagctcaggaggttcagtctggcctgtggctgttaaaccaggccatcggc
tcgctacgaacctccgtcaccaacacagcgctgcacagccacatagacaacagcctcaga
aacatcttcagcatcggacaggtgctgcgcagcctcaacatccaggagtacacccctcca
gcagggggagtggctggaggtgaggagacatggcgggtgtcgtctgcttcagagctcctc
caggtccacgttaacttcctgcgaggcaaggtgcacctcttgctgtccaacgcgcccatc
tgcaaccagggtagcagctga

DBGET integrated database retrieval system