KEGG   Salmo salar (Atlantic salmon): 106609057Help
Entry
106609057         CDS       T04363                                 

Gene name
hdac8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106609057 (hdac8)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106609057 (hdac8)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     106609057 (hdac8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 106609057
NCBI-ProteinID: XP_014062898
UniProt: A0A1S3SF02
LinkDB All DBs
Position
ssa07
AA seq 387 aa AA seqDB search
MSCKGDSNDSPSKRKVVYVYSPQYTETCDSLSKVPNRASMVHSLIEAYGLLQHMSVVKPR
VATIEEMAKFHTDAYLEHLHKISQDGDNDDPQSGDFGLGYDCPVVEGIYDYAAAVGGATL
TAAQCLLDKRGEVAINWAGGWHHAKKDEASGFCYVNDAVLGILKLREKYERVLYVDVDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDLCDTGMGKGRWYAVNVPLDDGIKDDRY
FHVFTSVMQEVKALFNPEAVVMQLGADTMAGDPMCSFNMTPVGVAQCLCHVLDWHLPTLL
LGGGGYNLANTARCWTYLTGAVLRQTLASEIPDHEFFTEYGPDYSLEISPSCRPDRNETK
QLDKVISTIKAVLLLRDCAVPAPLTHC
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtaaaggagattcaaatgactctccttccaaacgcaaagttgtgtatgtctat
agtcctcaatacaccgagacatgcgactcgctatcaaaagtccccaaccgggcaagtatg
gtgcattcactcatagaagcttatggtttacttcaacacatgagtgttgtgaagccccgt
gttgcgaccattgaggagatggccaagttccacacagacgcctacctggagcacctccac
aaaatcagccaggatggagacaatgatgacccccagtccggagactttggcctgggttat
gactgcccggtggtggagggtatctatgactatgctgcagcggtgggtggtgccaccctg
acggctgcccagtgcctgctggacaagaggggtgaggtggcaatcaactgggcaggaggc
tggcaccacgccaagaaggatgaggcatcaggcttctgttatgtgaatgatgctgtgctg
ggtattctcaagctgagagagaaatacgagagagttctttatgtggatgtggaccttcat
catggagatggtgtggaagatgccttcagttttacctccaaagtgatgactgtgtctcta
cacaagttctcccccggattcttcccaggtacaggggacctgtgtgacacagggatgggt
aaaggaagatggtacgctgtcaacgtccctctggatgacggcatcaaagacgacagatat
ttccacgtcttcaccagtgtgatgcaggaagtgaaggcgttgtttaacccggaagcagta
gtgatgcagctaggagctgacaccatggccggggaccccatgtgttccttcaacatgacc
cctgtaggggtggcccagtgtctttgccacgtactagactggcacctacccacactgctg
ttgggaggaggtgggtataacctagccaacacggcccgttgttggacctacctgactggg
gccgtactgagacaaacactggcctctgagatacctgaccatgagttcttcacagagtac
ggtcctgattactctctggagatcagtcccagctgtcgacctgaccgcaatgagaccaaa
cagctggacaaggtcatctccaccatcaaagccgtcctcttattgcgtgattgcgccgtg
cctgctccacttactcattgctag

DBGET integrated database retrieval system