KEGG   Salmo salar (Atlantic salmon): 106609100
Entry
106609100         CDS       T04363                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106609100
   04068 FoxO signaling pathway
    106609100
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106609100
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106609100
NCBI-ProteinID: XP_014062979
UniProt: A0A1S3SF51
LinkDB
Position
ssa07
AA seq 191 aa
MCNNMSNVSLSNGSPTLERVDPRPTDHTKPPIRRNLFGSVDHDEFRRECLVQMKEMEKAS
IDKWNYDFLNDKPLSQGDYKWEPMKSSDLPDFYSRPPHKRVWSSGNVDHNGNHDYRVRPS
CPTNGAELSEETEKSERQTHCHHSHNRARKRPVNPEPQSTGKKSHSSEEDEVVSKSVEQT
PSKNDSRTHEH
NT seq 576 nt   +upstreamnt  +downstreamnt
atgtgcaacaacatgtcaaatgttagtctttcgaatgggagtccgacgttggaaagggtg
gatccgcgtccgacggatcacacgaagcccccgattcgcagaaatcttttcggatcggta
gatcacgacgaatttaggagggagtgtttggttcaaatgaaagagatggagaaggcttct
attgacaaatggaattatgatttcctgaacgacaagcccctttcccagggagattataaa
tgggaacccatgaaaagcagtgacctgcctgacttttacagcagaccgcctcacaagcga
gtctggtcctctggaaatgtggaccataacgggaatcatgattaccgagtccgaccgagc
tgtcctacgaacggggctgagctatccgaggagactgagaagagcgagaggcagacgcat
tgtcaccactctcacaaccgggcaaggaaaagacctgtaaatccagaaccccaaagtact
ggtaaaaagtcacattccagtgaagaggatgaagttgtgtcaaagtcagtagagcagaca
cccagcaaaaacgattccaggacacatgaacactaa

DBGET integrated database retrieval system