KEGG   Salmo salar (Atlantic salmon): 106609776
Entry
106609776         CDS       T04363                                 

Definition
(RefSeq) smoothened homolog
  KO
K06226  smoothened
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106609776
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sasa04030]
    106609776
G protein-coupled receptors [BR:sasa04030]
 Frizzled / Smoothened family
  106609776
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR RNase_PH
Other DBs
NCBI-GeneID: 106609776
NCBI-ProteinID: XP_014064264
UniProt: A0A1S3SIU6
LinkDB
Position
ssa07
AA seq 832 aa
MSSHGWSSIVGGFGMLCVWAASFLVTHAVTVQRNETIFNDFCKKTTTCEVLKYNTCLGSP
LPYTHTSLVLAEDSSTQDEAFEKLAMWSGLRNAPRCWAVIQPLLCAVYMPKCDNGQVELP
SQHLCQATRRPCSIVDQERGWPNFLKCEETDKYPMGCTNEVQKLKFNTSGQCEAPLVKTD
VQASWYKDVEGCGIQCNNPLFTDEEHSDMHAYIAVFGTVTLLCTFFTLATFLADWKNSNR
YPAVILFYINTCFFMGSIGWLAQFMDGARKEIVCKSDNTMRLGEPSSTETLSCVIIFSLV
YYSLMSGVIWFVMLTYAWHTSFKALGTTHQPLSGKTSYFHMVTWSVPFILTVAILATAEV
DGDSVSGICFVGYKNYHYRAGFVLAPIGVVLVIGGYFLIRGVMTLFSIKSNHPGLLSEKA
ASKINETMLRLGIFGFLAFGFVLITFGCHFYDFFNQAEWEKSFREYVLCEANVTIAHQTN
KPIPECTIKNRPSLLVEKINLFSMFGTGIAMSTWVWTKATILIWKRTWCKVIGRSDDEPK
RIKKSKMIAKAFSKRKELHKDPEKELSFSMHTVSHDGPVAGINFDLNGEPSNEMSSAWAQ
HVTKMVARRGAILPQDISVTPTGTPVPPPEERNKLWMVEAEISPEMMMKRKKKRKKRKKE
ARPLEELAEHQGYRRREFGTSSVPRLPKLPGHRSLVANLRQHQEEAEDVLPGSYPEFRPS
HPLPDQERYGGALGASSSQRSRYPDLNPLSLSDLPEDLGLGPRCRPQQPPPSFWQPNGAF
HYSGEVAPMAGVSGRTDHVGRSQGGQRRAEWGQIHSRTNLMEAELMDADSDF
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgtcttcccatggctggagttccattgttggtgggttcgggatgctttgcgtttgggct
gcctcctttctggttactcatgcggtaacggtccagagaaacgaaacaattttcaatgat
ttctgcaagaaaactacaacatgtgaagtgcttaaatataatacatgtcttgggtcacca
ctaccgtacacgcacacgtctcttgtcttggctgaagactcaagtacccaagacgaagca
tttgagaagttggccatgtggtctggtctgaggaacgcccctcgctgctgggcggtcatc
cagcccctgctgtgtgcagtctacatgcccaagtgtgacaacgggcaggtggagcttccc
agccagcatctgtgccaggctacacgtcgcccctgcagcatcgtggaccaggagaggggc
tggcccaacttcctcaagtgtgaggagacggacaagtaccccatgggctgcacgaacgag
gtgcagaagctgaagttcaacacgtcgggacagtgcgaagcccccctggtgaagacagac
gttcaggccagctggtacaaagatgtggagggctgcggcatccagtgcaacaaccctctg
ttcaccgacgaggagcactcggacatgcacgcctacatcgctgtgttcggcaccgtcacc
ctgctctgcacctttttcactctggccacctttctggcggactggaagaattcaaaccgt
taccctgccgtcatcctcttctacatcaatacctgtttcttcatgggcagtatcggctgg
ctggctcagttcatggatggagctcgcaaagagatcgtgtgtaagagtgacaacaccatg
cgtttaggggagccctcgtctaccgagactctgtcgtgtgtcatcatcttcagcctcgtc
tactactccctgatgtctggggtgatctggttcgtcatgctgacctacgcctggcacacg
tccttcaaggccctgggcaccacccaccagcccctgtcgggcaagacctcatacttccac
atggtcacatggtccgtccccttcatcctcactgtggctattctagccaccgctgaggtg
gacggagactctgtcagtgggatctgtttcgtgggctataagaactaccactaccgtgct
ggctttgtgttggctcccattggagttgtgcttgtcattggtggctatttcctcatacga
ggagtcatgacgttgttttccatcaagagtaaccacccgggtcttctgagtgagaaggca
gcgagcaaaatcaacgaaacaatgctaagacttggtatatttgggttcctggcgtttggc
tttgtcttaatcacgtttggctgccacttctacgacttcttcaaccaggctgagtgggag
aagagcttcagagaatatgtgttgtgtgaggccaatgtgacgatcgctcatcagaccaac
aagccgatcccagaatgtactatcaagaaccgtcccagtctactggtggaaaagattaat
ctgttctccatgttcggcacgggcatcgccatgagcacctgggtgtggaccaaggccact
atcctcatctggaaacgcacctggtgcaaggttatcggccgtagcgacgatgagcccaag
aggataaagaagagcaagatgatagccaaggccttctccaagcgcaaggagctccacaaa
gacccagagaaggagctgtccttcagcatgcacacggtctcccatgatgggccagtagct
ggcatcaactttgacctgaacggggagccatccaacgagatgtcttcagcctgggcccag
catgtgaccaagatggtggccaggaggggcgccattctgccgcaggacatctctgtcacc
cctacagggacacctgttccacccccagaagagaggaacaagctgtggatggtggaggcg
gagatctcccctgagatgatgatgaagaggaagaagaagaggaagaagaggaagaaggag
gcacgtcctctggaggagctggccgaacaccagggctaccgtcggcgagagtttggcacc
agctcggtgccacggctacccaagctgcccggccacaggagcctggtggccaatctgagg
cagcaccaggaggaggctgaggacgtccttccaggctcttaccctgagtttaggccctct
catccgctgcctgaccaagagaggtacggaggagccctgggggcctcctctagccagagg
agcaggtaccctgacctcaaccccctctccctcagtgacctgccagaggacctcggcctg
gggcctcgctgccgcccccaacaaccacccccctccttctggcagcccaatggagcgttc
cactactccggggaggtggcgcctatggcaggggtgtctgggaggacagaccacgtgggg
aggtcgcaggggggtcaaaggagggcggagtgggggcagatccactctagaaccaacctg
atggaggcggagcttatggatgctgactctgacttctga

DBGET integrated database retrieval system