KEGG   Salmo salar (Atlantic salmon): 106610218
Entry
106610218         CDS       T04363                                 

Gene name
hhip
Definition
(RefSeq) hedgehog interacting protein
  KO
K06231  hedgehog interacting protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106610218 (hhip)
SSDB
Motif
Pfam: GSDH EGF_2 Ntox30
Other DBs
NCBI-GeneID: 106610218
NCBI-ProteinID: XP_014064901
UniProt: A0A1S3SKP5
LinkDB
Position
ssa08
AA seq 697 aa
MRHLKFVLVLAIAVNVWECGDSKFGEKGEISPRRRRCYDGSMPKRLKKRERKLSVDSGAS
SGEVCHRLYPRVSCCPTRRAAYQIVHRRDARIFSTNNTECSRLLEEIKCAHCSPNAQVLF
HSPESDKVPLREPHLPRLCQDYCREFYYTCRGHIPELFQADVDEFCQYYGRRDGGLCFPD
FHRKQTRGQDSNYLGDEKVEDINRKHKHNCYCAQVVLSGLRQPVAVVHCGDGSQRLFVLE
KEGFVRVLTHNMELLKEPFLDIHKLVQTGLKAGDERGLLGLTFHPNYKKNGKLYVSYTTN
QERWAIGPHDHILRVVEYTVSRKNPNMVDSRTMRMLIEVAELHRKHLGGQLLFGPDGLLH
IVLGDGMITLDDMEEMDGLSDFTGSVLRVDVDTDCCTAPYSIPRNNPYFNSTNQPPEIFA
HGLHDPGRCAVDRHHTDNNGSLLILCTDASGRNASAGRILAITKGKDYENEASIFDLATS
GGAAPVGGFIYRGCQSRRLYGSYVFGDKNGNLRILQKGSAAARDQWQEKALCLGTSSSCG
SALVGHILGFGEDQLGEVYILATSKNMAQSHSGKLYKLVDPKRPAVPKECQRQVEAPELL
GTACSRQCKNGHCTPTGKCCCSTGWEGPFCRVAKCEPACRNGGVCVEPHNCLCKSGYSGA
QCEKGERGMPSDQEKDGILDHIIDMTSYLLNLTSYMV
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgaggcatttgaaatttgtactcgtgttggctattgcagtcaacgtttgggaatgtggg
gattcgaaatttggcgagaagggggaaataagcccgaggagaaggagatgttacgacggg
agcatgcccaagcgactgaagaagagggaaagaaaactgtcagtggacagcggtgcaagc
agcggggaagtttgtcacaggttgtaccctcgtgtgtcatgctgcccaaccaggcgtgct
gcttatcagatagtccaccggcgtgatgccaggatcttctccaccaataacacggagtgc
agccgtctcctggaggagattaagtgtgcacactgttcgcccaacgcccaagtgctgttc
cactcccctgagtcggacaaggtccccctcagggagccccacctgccacgcctctgccag
gactactgtcgagagttctactatacctgccgcggacacataccagagctgttccaagcc
gatgtggatgagttctgtcaatactacggacggagggacggaggcctgtgcttcccagat
ttccaccgaaagcaaacacggggacaggactccaactacttgggagatgagaaagtcgaa
gacatcaacaggaagcacaagcacaactgctactgtgcccaggtggtgttgagcgggctg
aggcagccagtagccgtggtgcactgtggggacggatcccagcgcctctttgtcctggag
aaggagggcttcgtccgggtgctgacccataacatggagctgctgaaagagcctttcctg
gacatccacaagctggtgcagaccggactcaaggcaggagatgaaaggggtttgctgggt
ctcacattccaccccaattacaagaagaacggcaagctgtatgtctcctacaccaccaac
caggagcgctgggccatcggaccgcacgaccacattctgcgcgtggtcgagtacaccgtc
tccaggaaaaacccgaacatggtggacagtaggaccatgcggatgctgatagaagtggca
gagctgcacaggaagcacctgggaggacagctgctgtttggccctgacggcctgctgcac
atcgtcctgggagacggcatgatcaccctggacgacatggaggagatggacggcctcagt
gatttcacagggtctgtgttgagggtggacgtggacacagactgctgcacggctccctac
tccatacccaggaacaacccctacttcaacagcaccaaccagccaccagaaatctttgcc
cacggattgcatgacccaggcaggtgtgccgtggaccggcatcatacggataacaacggg
agtctgttgatcctgtgcacggacgccagcggcaggaacgcgtcagcagggagaatactg
gcgatcactaaggggaaagactacgagaacgaggcgtccatctttgacctggcgaccagt
ggaggagcagcacctgtgggagggttcatctacagaggctgtcagtccagaaggctctac
gggagctatgtgttcggagacaagaacgggaacctgcggatcctccagaagggctcagcg
gcggcgagggaccagtggcaggaaaaagctctgtgtctggggaccagcagctcctgtggc
tccgctctggtgggacatatcctgggcttcggagaggaccaactaggtgaagtgtacatc
ctggccaccagtaaaaacatggctcagtcacacagtgggaagctctacaagctagtggac
cctaaaaggcccgcggtccctaaggagtgtcagagacaggtggaggccccggagctgctg
ggaacggcctgctcacggcagtgtaagaacggacactgtacccccaccgggaagtgttgc
tgcagcaccggctgggagggacccttctgcagagtggctaaatgcgagccggcctgtcgt
aacggtggcgtgtgtgttgagccccacaactgcctgtgtaagagcggctactcgggcgcc
cagtgtgagaagggcgagcggggcatgcctagcgaccaggagaaggacggcatcctggac
cacatcatagacatgacctcgtacctgctgaacctcactagctacatggtatag

DBGET integrated database retrieval system