KEGG   Salmo salar (Atlantic salmon): 106611584
Entry
106611584         CDS       T04363                                 

Gene name
egf
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04068  FoxO signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106611584 (egf)
   04012 ErbB signaling pathway
    106611584 (egf)
   04068 FoxO signaling pathway
    106611584 (egf)
   04020 Calcium signaling pathway
    106611584 (egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106611584 (egf)
   04540 Gap junction
    106611584 (egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106611584 (egf)
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106611584 (egf)
SSDB
Motif
Pfam: Ldl_recept_b cEGF EGF_CA FXa_inhibition EGF DUF5050 EGF_3 EGF_MSP1_1 SGL Plasmod_Pvs28 hEGF
Other DBs
NCBI-GeneID: 106611584
NCBI-ProteinID: XP_014067426
UniProt: A0A1S3SSV5
LinkDB
Position
ssa09
AA seq 1198 aa
MLVVTVAAVLVYFSVQNDGASAAPGKACWLVDPSGVGNGSCVAPEPYLIFGHGKAIYRMD
LDGGNQKRVVTGVGNSILLDFHYTEGRVYWADKKTGVIYKAAMDGTQRQKLHSSEKGISG
LAVDWVHNFVIWTSGEVGSIKRVDTDGKNERTLLRHLSQPISIAVAPNDRFIFWLSDGIT
PSIQRSDVAGEMITTVLKIPERLGGLSVDRTDKRLFWVQFSLEGESAIGSCDYNGNVVNV
IDQPLLSQSLGMSVFLEQVYYTDMSSRTIRQVNKYSGVEAENINLKRMTHPSTAVKVVHP
LSQPIEDSMPVFPACDGRTGVCVNVCSNPAEQGICQCTKGFALSKHGNYCEDVNECGLWD
HGCSLGCENIPGSYFCTCPKGYALLPDRKTCQETSPCLANMTQCDNGCLATDEGTICVCP
EGSILQPDGQTCRGCSSSDRGGCSQQCSPITPGRWECDCLPGYKIHQDGKRCTATGPPPY
LLFANIVNIRRVNLDGTGDQSLVEEPRGTVIALDYDPVQNKVYFASTVLKQIERADLDGG
SREVLLTEGLDSPEGLAVDWVNRKLYWTDRGLSTIDRSTLDGFDRETIISKGIQKPRGIA
VHPLAKKLFWTDMGTRPVLESASLEGSDRAVIASTDLVSPSGLTIDFTEDRLYWCDSQRG
VLEMASLDGSNRQVLTENEVGRPFDLVVFEDRLWITDREQQLLLSVDKRTGMNPERLHGN
MVQPASIVVVHPLAKPGANVCLYQNGGCAQVCESRLGFAHCSCHSHIAQSADGKDCLPSY
GSTDSGDGESADPFSLKNKTLNDESMPLPVPGLSTDGEEAEDNLDEGSEPTLFIEKMVSD
QDDCFSLRCDVNAQCLLDGGNPTCHCLEGFTGDGELCVDLDECMLGMTLCSIQSSVCVNT
AGGYYCQCRPGFSGEEHHCTDIDECKMGTHKCDERAECINTIGKYRCKCQAGYSGNGHTC
QELSTTSSWVTTSRPMDVTSQWLNTNTVESCPSSHDTYCLYEGVCFYFPEMESYACNCIS
GYMGERCQFSDLEWWELQQAEQEKRRNVAIALGMVVLITLLSIAACVTYCYGSRRFIRKH
PSVDDMSETSTSDDTMSETTVPKTPRFYVVLEHGGDGKVIHVMGSPRRVVCPSCSSETGE
SFVSEEVVTLPRLNKGYECSFGLATMETNKTGANHLKSIDNLIFLDDPQPVSAIPQLT
NT seq 3597 nt   +upstreamnt  +downstreamnt
atgttggtcgtgacggtcgcagcagtgctggtctatttctcagtgcaaaacgacggagcc
tcagcggcccctgggaaggcatgttggctcgtagacccatcaggtgtgggtaatgggagc
tgtgtggctccagagccctatctgatcttcggccatggtaaggctatataccgaatggac
cttgacggagggaatcaaaaaagggttgtgaccggtgttggaaactctattctactggac
ttccactacacagaggggagagtttactgggccgataaaaagacaggggtcatctacaaa
gcagcgatggatggaacacagagacagaagctgcactcatctgagaaagggatctcaggc
cttgcggtcgactgggttcacaattttgtcatctggaccagtggagaagtgggaagtatc
aaaagagtggatacagatggtaaaaacgagaggactcttctaagacatttatctcagcca
atctccatagcagtcgccccaaatgacagatttatattctggctgtccgacgggatcaca
cccagtattcagaggtcggatgtagcgggagagatgattactacagtgctgaagattccg
gagagactgggagggctgtcggtcgaccggacggacaagagactgttctgggtccagttc
agtctggagggagaaagtgccattgggtcgtgtgactacaacgggaatgttgtcaatgtc
attgaccagccactactgtctcagtctttggggatgtctgtgttcctggagcaagtctac
tacactgatatgagttcacggaccatacggcaagtcaataagtactcaggggttgaggca
gagaacatcaacctaaagcgaatgacacacccctctactgctgtcaaggtggtacatccc
ctcagccagccaattgaagactccatgcctgtctttccagcgtgtgatggtcgtacagga
gtgtgtgtgaatgtgtgctccaacccagctgagcaggggatctgccagtgcactaaaggc
tttgctcttagcaaacatgggaactactgtgaagatgtcaatgagtgtggcctgtgggac
cacggctgttccctgggctgtgagaacattccaggctcctacttctgcacctgccccaag
ggttacgctctgcttcctgataggaaaacctgccaagagacctcaccatgtctggccaat
atgacccagtgcgataatggatgtcttgctactgatgaggggaccatctgtgtgtgtcca
gaggggtccatactacagccggatggacagacctgtagaggctgctcctcttccgaccga
gggggctgtagtcagcaatgttcccccatcactcctggtaggtgggagtgtgactgtctg
cccgggtacaagatccaccaagacggtaaacgctgcacagccactggacccccaccttat
ctgctgtttgccaacatagtaaacatcagacgtgttaatctggatgggactggtgaccaa
agccttgtggaggagccgaggggaacagtgatagctctggactacgatcctgtacaaaac
aaagtgtactttgccagtacagtactgaagcagattgagagggctgatttggacggcggg
tccagggaggttttgctcactgaggggttggactcaccagagggcctggctgtggactgg
gtcaaccgcaagctctactggactgaccgaggcctctcaactattgaccgcagcaccttg
gatggcttcgacagagagaccattattagcaaaggcatacagaaaccaaggggaattgca
gttcatcctttagccaagaagttgttctggaccgatatgggtaccaggcctgtgttggag
agtgcgtctttggaaggaagtgaccgtgcggtcattgcgagcactgacttggtgtctcct
agcggtctgaccattgacttcactgaagacaggctgtactggtgtgacagccagaggggc
gtactggagatggcatccctggatggctccaaccgacaagtcctgacagagaacgaagta
ggtcgaccttttgacctggtagtgtttgaggacaggttgtggatcacggacagggagcag
cagctgctcctgagtgttgacaagcggacggggatgaacccagagcgtctacatggcaac
atggtccaaccggcatccatagttgtggttcaccccctcgccaagccaggagcaaatgtt
tgtctctatcaaaatgggggctgtgctcaggtgtgcgagagcaggctaggattcgcccac
tgctcctgtcactcacacattgcccaatcagctgacggcaaagattgcttgccatcctac
ggatcaacagattctggagatggcgagtctgcagacccgttctctctgaaaaacaaaact
ttgaacgatgaaagcatgcctctccctgtgcctggtctctctactgacggggaggaggca
gaggacaacctggacgaagggagtgagcccacactcttcattgagaagatggtgtcagac
caggatgactgtttctctctccgttgtgatgtgaatgcacaatgtctactggatggaggc
aaccccacctgccactgcctggaaggtttcactggggatggagagctgtgtgtggacctt
gatgagtgcatgttggggatgaccctgtgtagtatccagagctcagtgtgtgtcaacacc
gctggaggatattactgccagtgtcgccctggcttcagtggagaggaacaccactgtacc
gatattgacgagtgtaaaatgggaacacacaaatgtgatgagcgagcggaatgcatcaat
actatagggaagtaccgctgcaagtgtcaagctggctacagtggtaatggacacacatgc
caagagttgtcaactacgtcctcgtgggtgaccaccagtaggcctatggacgtcaccagc
caatggctgaacactaacacagtggagagctgcccctcatctcatgacacttactgtctc
tacgagggagtctgcttttacttcccagagatggagtcctatgcctgcaactgtatctcg
ggctacatgggagagcgctgtcagttcagtgatctggagtggtgggagctgcagcaggcc
gaacaggagaagagaaggaacgtggctatcgccctgggcatggtggtcctcatcaccctg
ctctccatcgctgcctgcgtcacctactgctacgggtccaggagattcattcggaaacac
ccctctgtggatgacatgagcgagacaagcaccagtgatgacaccatgtcagagaccacc
gtccccaagacgccacggttctatgttgttttggaacacggtggcgatggaaaggtcatt
cacgtcatgggctctccaagaagagttgtttgtccctcttgctcctccgaaacaggtgaa
agctttgtgtcagaggaggtagtgactcttcccagactcaacaaagggtacgagtgctct
tttggattggctaccatggagaccaacaagacaggcgccaaccacctcaagtccatcgac
aacctcatcttcctggatgaccctcagcctgtctctgccatccctcagctcacctga

DBGET integrated database retrieval system