KEGG   Salmo salar (Atlantic salmon): 106612430Help
Entry
106612430         CDS       T04363                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00010  Glycolysis / Gluconeogenesis
sasa00051  Fructose and mannose metabolism
sasa00052  Galactose metabolism
sasa00500  Starch and sucrose metabolism
sasa00520  Amino sugar and nucleotide sugar metabolism
sasa00524  Neomycin, kanamycin and gentamicin biosynthesis
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
sasa04910  Insulin signaling pathway
Module
sasa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sasa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106612430
   00051 Fructose and mannose metabolism
    106612430
   00052 Galactose metabolism
    106612430
   00500 Starch and sucrose metabolism
    106612430
   00520 Amino sugar and nucleotide sugar metabolism
    106612430
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106612430
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106612430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106612430
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106612430
Membrane trafficking [BR:sasa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106612430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 106612430
NCBI-ProteinID: XP_014069021
UniProt: A0A1S3SXE7
LinkDB All DBs
Position
ssa01
AA seq 919 aa AA seqDB search
MIAAQLLAYYFTELKDDKVKKIDKYLYAMRFSDETLMDIMKRFRRELGNGLGRDTNHTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSAFRILRVKVSHEKKQTVQMESQIYDTPEDIIH
GSGARLFDHVAECLGDFMEKQNIKDKKLSVGFTFSFPCAQTKLNESYLLTWTKRFKASGV
EGMDVVTLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGMLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGFLFEGRITPELLTKGKFETKHVSSIEKSKEGLTKAKDILGRLG
VEPSADDCIAVQHVCTIVSHRSANLIAATLGGILSRLKDNKGNPRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPESDVRFLLSESGSSKGAAMVTAVAYRLADQRRQITETLAEFRLT
SDQLLEVKKRMRTEIQNGLGEKTHDSATVKMWPTYVLSTPDGSENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPMEVMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGF
TFSFPCRQTSLDVGILVTWTKGFKATDCEGEDVVGLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNIEMVEGDVGRMCVNMEWGAFGDNGCLDD
IRTEYDRAVDDFSLNPGKQRYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQQLGLDSTCDDSIIVKEVCGTVSHRAAQLCGAGMAA
VVDKIRENRGLNQMDITVGVDGTLYKLHPHFSGIMHQTVKELAPKCNVNFLLSEDGSGKG
AALITAVGCRMREQEEQKS
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcagcacagcttctggcctactacttcactgaattgaaggatgacaaagtcaaa
aagatcgataagtacctgtacgccatgcgtttctccgacgagacgctgatggacatcatg
aagcgattcaggagggaactggggaatgggctgggtcgggacactaaccacacagcaact
gtcaagatgctgcccaccttcgtcaggtccattcctgatgggtcagagaagggggacttc
attgctctggatctgggaggctcggccttccgcatcctgcgagtgaaggtgtcccatgag
aagaagcagacagttcagatggagagccagatctatgacactccagaggacatcatccat
ggcagtggcgctcggctgtttgaccatgttgcagagtgcctgggtgacttcatggagaag
cagaatatcaaggataagaagctttctgtcggcttcaccttctccttcccctgtgcacaa
accaaactgaatgagagttatttgctcacttggacaaaacgctttaaagccagtggagtt
gagggaatggacgttgtgactcttctgaacaaggccatcaaaaaacgtggggactatgac
gcagacatcatggcagtggtcaatgacacagttggaaccatgatgacctgtggctttgat
gaccagcgttgtgaagttggtatcatcataggcacaggtactaatgcttgttacatggag
gagctaaggcacattgacctggtggagggagacgagggcagaatgtgtatcaacacagag
tggggagcctttggggacgatggaatgctggaggacattcgcacagagttcgacagagaa
attgacaggggctctctaaacccagggaaacagctgtttgagaagatggtcagtgggatg
tacatgggcgaacttgtgcgactcatcctggtcaagatggccaaagagggatttttgttt
gagggtcggataacgcctgaacttcttaccaaagggaaatttgaaactaaacacgtttct
tccattgaaaagagtaaagaaggcctcactaaagccaaggatatcctaggtcggctgggc
gtggaaccatccgcagatgactgcattgctgtgcagcacgtatgcaccatagtctcccac
agatcagccaacctcatcgctgccactctgggcggcatcctctccaggctaaaggacaac
aaagggaaccctcgcctacgcaccactgtgggcatcgacggctctctctacaagatgcac
ccgcaatatgcccggcgtctccacaaaacagtccgccgcctagttcctgagtcagatgtc
cgcttcctgctttcagagagtgggagctccaagggcgctgccatggtgaccgccgtggcc
taccggctggctgaccagcgtcgtcagatcacagagaccctggctgagttcagactgacc
agtgaccagctgctggaggtgaagaagaggatgaggacggagatccagaatggcctgggg
gaaaagacccatgacagcgccaccgtcaagatgtggcccacatatgtactcagcacacca
gatggatcagaaaatggtgatttcttggctttggatttaggagggacaaactttagagtg
ctgttggtgaagattcgcagtggcaagcggcgaacagtagagatgcataacaaaatttat
gctattcctatggaggtgatgcaggggactggagaggagctgtttgaccacattgtccag
tgcatatctgacttcctggactacatgggtatgaagaacactcgcctgcctctgggtttc
accttctccttcccctgcagacagaccagcttggatgtgggcatcctggtaacctggacc
aaaggcttcaaagccactgactgtgaaggggaggatgttgtcgggcttctcagagagggg
ataaaaaggagagaggagtttgacttggacgtggtggcagtagttaatgacacagtgggg
accatgatgacatgtgcatatgaagagcctacctgtgaggtcggcctgatcgcaggaact
ggcagcaacgcctgttacatggaggagatgaggaacattgagatggtggagggggatgtg
gggaggatgtgtgtcaacatggagtggggcgccttcggggacaatgggtgcctggatgat
atcaggacagaatatgacagagctgtggatgacttttcactcaaccctggaaaacagagg
tatgagaagatgtgcagcggtatgtatctcggggagattgtgcgaaacatcctgatcgac
ttgacgaagcgtggctttctcttcagagggcagatatcagagactctgaagaccagaggc
attttcgaaactaagttcctctcccagattgaaagtgaccggttggcgctactgcaggtg
aggtccatcctgcagcagctgggtctggacagcacatgtgatgacagtatcatcgtcaag
gaggtgtgtggtacagtgtctcaccgggcggctcagctctgtggagccggaatggctgcc
gttgtcgacaaaatccgagagaaccgtgggctgaaccaaatggacatcaccgttggggtg
gacggaacactctacaagctgcatccacacttctcagggatcatgcaccagacagtgaaa
gagttggcccctaagtgcaacgtcaacttccttctctctgaggacgggagcggcaagggt
gcagccctcatcaccgctgtgggctgtcgcatgcgtgagcaggaggagcagaagagctga

DBGET integrated database retrieval system