KEGG   Salmo salar (Atlantic salmon): 106612729Help
Entry
106612729         CDS       T04363                                 

Gene name
FXYD6
Definition
(RefSeq) FXYD domain-containing ion transport regulator 6-like
  KO
K13363  FXYD domain-containing ion transport regulator 6
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sasa02000]
    106612729 (FXYD6)
Transporters [BR:sasa02000]
 Other transporters
  Pores ion channels [TC:1]
   106612729 (FXYD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP1G1_PLM_MAT8 Glycophorin_A XK-related
Motif
Other DBs
NCBI-GeneID: 106612729
NCBI-ProteinID: XP_014069662
UniProt: A0A1S3SZA3
LinkDB All DBs
Position
ssa09
AA seq 106 aa AA seqDB search
METVLFFLFSLLVYVADGEKEKKEVDPFVYDYHSLRICGLVFGVVLFALGILLILSKSSY
FSRKCRCCPNQEKKPKAPGDEEATAETLIVSKAKEPEPEPEAKAEN
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgttctgttcttcctcttttcactcctggtgtatgtggctgatggtgaaaag
gagaagaaagaggtggacccatttgtctatgactatcatagcctgcggatctgtggactg
gtctttggtgtggtactcttcgcgctgggcatcctcctcatcctcagtaagtcttcatac
ttcagccgaaaatgtcgctgctgtcccaatcaggagaagaagcccaaggcccctggagac
gaagaggcgacggcagagacccttatcgtgtccaaagctaaggagccagagccagagcct
gaagctaaggctgagaactga

DBGET integrated database retrieval system