KEGG   Salmo salar (Atlantic salmon): 106612902Help
Entry
106612902         CDS       T04363                                 

Definition
(RefSeq) caspase-1-like
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04217  Necroptosis
sasa04621  NOD-like receptor signaling pathway
sasa04623  Cytosolic DNA-sensing pathway
sasa04625  C-type lectin receptor signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106612902
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106612902
   04623 Cytosolic DNA-sensing pathway
    106612902
   04625 C-type lectin receptor signaling pathway
    106612902
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106612902
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106612902
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106612902
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     106612902
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C14: caspase family
   106612902
Membrane trafficking [BR:sasa04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    106612902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD
Motif
Other DBs
NCBI-GeneID: 106612902
NCBI-ProteinID: XP_014070034
UniProt: A0A1S3T0C3
LinkDB All DBs
Position
ssa09
AA seq 383 aa AA seqDB search
MADKVLSNARKTFIDSVTKPVIKQLLDDLLEDKVLNDEETDSVTEENSTRAEQARCIIDM
VRKKGSKASEKMIARVQERDPGVYDKMGLAPRQPAQMRPSSPQLSRQEEHQVSSYLIPST
KDFKKDILQRKGSEIYPPMDKSGRKRLALLINNVEFDDKTMLRRGAEKDEENMERLLRDL
GYDVVKHRNLSGQEMDEAVKAFSKREEHLLSDSVFVVMMSHGVLGAIMGVHYKEGDPNSD
IFHINNIFTHLNTENCKALINKPKVILIQACRGGKDGSVWVSDKVPGSSLDLGFESDSIR
REHKEKDFISLLSCTPDTVSYRDPKLGTLFLQRIMEIFNTNACDDHIEELFRKVMGRFED
FPRQMPTKDRATLTKHFYLFPGL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaaggtgctctccaatgctcggaagacattcatagacagtgtgacgaagcca
gtgatcaagcagctcctggacgaccttttggaggacaaggtgctgaacgatgaagagaca
gactcagtgacggaggagaacagcactagggcagagcaggcacgatgcattatcgatatg
gtgcggaagaaagggagcaaagccagtgagaagatgattgccagagttcaggagagggat
cctggagtttatgacaaaatgggtctggcccccaggcagcctgcccagatgagaccatca
tcgccccagttatcacggcaggaggagcaccaggtgtcctcctacctcatccccagcaca
aaggactttaagaaggacattcttcagaggaagggtagcgagatttaccctccaatggat
aagtctggtcgaaagcgtctggccctgctcattaacaacgtggagtttgatgataagacc
atgctgagacgaggggcagagaaggacgaggagaacatggagaggcttctcagggatctg
ggatatgatgtggtgaaacacagaaacctgtctggacaggagatggacgaggctgtgaaa
gcgttctctaaacgtgaggagcacttattgtcggacagcgtcttcgtggtgatgatgtct
cacggggtgctgggagccatcatgggtgtccattacaaggaaggggaccctaattctgac
atcttccacatcaacaacatcttcacacacctgaacacagagaactgcaaagcactgatt
aacaaacccaaagtcatcctcattcaggcctgcaggggaggcaaggatgggtctgtttgg
gtcagtgacaaagtgcctgggtccagccttgacctggggtttgagagtgactcaatcagg
agggagcacaaagagaaggacttcatctccctcctctcctgcacaccagatactgtgtcc
tacagagatccaaagttgggcaccctttttctccaacgcatcatggagatattcaacacc
aatgcctgtgatgatcatatagaagaattgttcagaaaggtcatgggacgctttgaagat
ttccccagacagatgccgaccaaagacagagccactctaacaaagcacttctacctcttc
ccaggcctctga

DBGET integrated database retrieval system