KEGG   Salmo salar (Atlantic salmon): 106612994
Entry
106612994         CDS       T04363                                 

Gene name
atm
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa03440  Homologous recombination
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    106612994 (atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106612994 (atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106612994 (atm)
   04210 Apoptosis
    106612994 (atm)
   04115 p53 signaling pathway
    106612994 (atm)
   04218 Cellular senescence
    106612994 (atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106612994 (atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    106612994 (atm)
   03400 DNA repair and recombination proteins [BR:sasa03400]
    106612994 (atm)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106612994 (atm)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   106612994 (atm)
DNA replication proteins [BR:sasa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     106612994 (atm)
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    106612994 (atm)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC HEAT DUF3349
Other DBs
NCBI-GeneID: 106612994
NCBI-ProteinID: XP_014070253
UniProt: A0A1S3T0X9
LinkDB
Position
ssa09
AA seq 3102 aa
MSLVLHELLVCCKGLENDKATERKKEADRFRQLIRSPDTVEELDRTSGTRAAKSSKQLTW
NAVFRFLQKYLQKETELLQSGKANVSATTQANRQKKMQEISSLVKYFIRCANKRGPRLNC
GELLNHVMEVLRSSFSCSAYGEDYSSILLKNILSVRKYWCDITKQQWHDLLDLYCGLFTG
SSKAINRVLVSRIIHTVVKGCCLQTEGFSHTLFSFFSRALLNARQERHLAVVEHLISALN
VFLRSAAMNCRIRVCRLGEELLPSVLYVWTQMRPSTTLKEEIVEFFNLQLCVHHPKGSKT
QDTGAYAEDWVKWQSLLYNLYDALVSEISQIGSRGKYATGSRHIAVKENLMELTAEICHQ
LFSEDCNLQILEVTQAHLRATQRGSPHGTPSKRRRIELGWEVLRDHLQPHHSDFDIIPWL
QITSVLTSKYPSMVPGQELVPLLSVLCQLLGEQRRGDRGPYVLRCMREVARCQATHPERA
QSYRAELGRLWGRVWVLALRGVSSPQTEALSLALLSTILQGAFIPIDRELWKLFSGSACK
PSDAAALCLAQALLKCPVLKSLGPGWDHAGAVEGVGPPSLKENIMSWLLMNEQSEEAEES
SRPHPIICRDFPHNLIPRILVPLTLKDTRAGIMFLLGAKGLESAVMQDQAQVEVKGALSE
IESMYLQFSFDEMPSNPMVKVMGSSAGTQLTVVPSLKHKLEQGLLSVADHLLNCYSPDSQ
STPPECLVRCSSLLTGVLAGYVSTGLLTEEEACHSQLFLKAKALVQDFSEYISNVKVKMA
EDGTMTTLRSVMRLCTQCVKRGVKDSMSSVSCNLFMKIFPARLLTELAEICKLLLNSSCK
RGSVGIEEETTDEDWDMTRTQADQQEDIDLFDDGDGPQTSTSKGTHRQNVDPNDTQCGPD
AKSLLAEEHLAQQDLAILASLEFLSLCVSAEFIHGLSFKPVEVRRKLLLLLEQIDCTKPL
HLNMYLVLLKKLPAEDTSLAAEEFDSLLRPLADLCSLYRQDQEICAAVLLGLLPSIRSLG
RTQDQQNDMRHVQGALLQVVSGFCILGRTGKCTAIVKVALIHCLLALLEADPCCKWAVLT
LREEELPVSVILPSHLSDSHHHVRMLAAMTVERLFLEMTPDSLEKRKMLPLKCQQTAFEN
VYLKAQEGMRVQKNSSPEDLSDETFNRKATLLKSVSVVLCCSPVCEKQSLFALFQSYKEN
NIEEPLIKKVLGSVSRALGYRSVEGFVSSHLDYLVAEWLGQHGYTLESFPYTLLNHATLK
DFYSSSYQVLIPHLVFLDDFKQVKSISTHLGKDWKKLLANCFPKIMVNILPYFAVSGQDA
QVAQQREKAHRVYDLLKDSNCLGKPQIDSLIHSNLSDIVVELLMTLYEGAATEEGGRGDL
RRFIGELDPAPNPPYFSSYVIKATLDYLSSCHSANLKSLVAILSKTPISIQRILLAVCQK
AAETINAYERHRILLMYYLFVSLLLKEVKDGLGGAWAFVLRDIIYTLIHHINSRPAQLDE
VSGRSFSLCCDLLTSVCRTAVQFCDDAVESHLQVIVGTLTAQVTNQLAISQQVLSLLKFL
VVESQDKLKSAIQKLEPFPDRPEFRELRAVQHTLKYSTGKFTLRQEIAHFLSVASCDSLP
LTRLEGLKDLRRQLHNNKSQIRPLLRECLADPAESVLVLLVLNLLQLCKLAANHPGGRDI
LEAAGSCLGELGPVDFSTIALLHGKDQLSARAVSLFPQMEPQWLYIILNCINNALTHHCI
EVRQAAVQSLKDILATQAGADFWEIHKDNRDPMLVYLNPFRSTKKKVGQTFQDLKYHILV
VGMSDEVSLVARERLESQDLWVPEAGGHKAWLKTLCMVLLDSGGVRSEALLLSRPMCLVK
TDFCQRVLPLIIHDILLGDSDGSWRKLLSTHIQDFLTSCSSRARASSRSTTPLPSDSAGE
SDISNQGPLDKASLRTMLSVINYLRQQQRPLESDSNLCGTVCHSNFWLELNYLEVARAAQ
SCSAHFTALLYSEIYVDKIKTNMEENRRNPARASRRITFDESSQNFAISSLTEESVKDTG
ISLQDLLIEVYRSIGEPDSLYGCGGGKMTSALTRIRTYEHEAMWGKALTSYDLHSNLPDG
TRQVGIVEGLQNIGLSSILATYLQGLESGGVEWGAELRELRFQAAWRNMQWDCDLSERNE
KLNPGFNESVFCSLQALRDKEFSTFDQTLKYARGNEVEELCRGSLEAVSSLYPALRNLQR
ISELESIRQLFSKPLTEVGLAEVCSHWQQHSQLLVDSDFTLVEPILALRSVAQETLISQE
RDPEKNKYLSTVLTSHLMELCQLARAAGNTQLAERAVFQMKQHGGGGGRGSTASSWQLEE
AQVFWAKGEQGLALGLLRQMIHTLEEQVLFNPALVPVFTECLRLCGNWLAETCLESPGVI
LEKYLERAVEVIEGHAIGSDTKLQSQRTQAFLSLARFSDAQYQGIHNYMKSSEFENKQAL
LVKAKEEVDLMRERKVSTNRYTVKVRRELELDERALSNLQADRRRFLCKAVENYIHCLEQ
GEEHDTWVFRLASLWLENADVKAVNDMMKGGVHRIPSYKFLPLMYQLAARMGTKMSATVA
EDVGFHGVLNELICLSCLEHPHHTLFIILALVNANKDESLSRSRLSKSTPRHSSQLDLER
SEVSQRVMNKIRKKRAQMIRGIEVLCDAYITLAYMDASRHKTEKKAILIPSDQPIMQIKN
LDDVIIPTMEIKVDPSGKYDNLVTIKSFKPHFHLAGGVNLPKIIECVGSDGKSRRQLVKG
QDDLRQDAVMQQVFHMCSMLLQRNTETRKRKLNIRRYKVVPFSQRSGVLEWCSGTIPIGD
FLIDPQKGAHTRFCPKDWTSITCRKKMMESQRLGSSGTTQAFSEVCQNFRPVFRYFCMER
FLDPAVWLEKRLAYTRSVATSSIVGYIVGLGDRHIQNILIDEQTAELVHIDLGVAFEQGK
ILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCEKTMEVMRSSQEALVTIVEVLLYDPLF
DWTMNPLKAFYLQQQHDEQAELQATLNSTLGGDILEAHPKSSSDSQSFNKVAERVLLRLQ
EKLKGVEDGRVLSVGGQVNLLIQQAMDPNNLSRLFPGWQAWV
NT seq 9309 nt   +upstreamnt  +downstreamnt
atgagcttggtccttcacgagctgctggtctgctgcaaaggtttagagaatgacaaagca
acggagagaaagaaagaggctgatcgcttcagacagctcatccggtctcctgacacagtg
gaggagctggatcgcacttctggaaccagagctgctaaaagttccaagcagctcacctgg
aatgcagtcttcaggtttctgcagaagtatctgcagaaagagactgagctgctccagtca
gggaaagccaacgtgtcagccaccacacaggctaaccgtcagaagaagatgcaggagatc
agcagcctggtcaaatacttcatccgctgtgccaacaagagagggcctcggctgaattgt
ggcgagctcctgaatcatgtgatggaggtgctgcggagctcattcagctgctcggcctat
ggggaggactacagcagcatcctgctcaagaacatcctgtctgtccgcaagtactggtgt
gacatcaccaagcagcagtggcacgatttgctggatctgtattgtggccttttcactggt
tcctccaaggccataaatcgtgtgcttgtgagcaggatcatccacactgtagtcaagggc
tgctgtctgcagactgagggcttcagccatacactcttcagcttcttctccagagcactg
ctcaatgccaggcaggagagacacttggcagtggtggagcacttgatctctgctctgaac
gtcttcctgaggtcagctgccatgaactgccgtatcagggtgtgtcggctgggtgaggag
ctcctgccctctgtgctctatgtgtggacacagatgaggcccagcaccactctcaaagag
gagatagtggagttcttcaacctgcagctctgtgtacatcatcccaaaggatcaaagaca
caagacacaggagcctacgctgaggactgggtcaaatggcagagtctactctataacctg
tacgatgccttggtgagtgagatcagccagattgggagccgggggaaatatgccacaggg
tcgcgccacatcgctgtgaaggagaaccttatggagctaactgcagaaatctgccatcag
ctctttagcgaggattgtaacctccagattctggaggtgactcaggcccacctcagagcc
acccagagaggcagtccacacggcacgcccagcaaacgtagacgcatcgagctgggctgg
gaggttctccgagaccacctgcagccacaccatagtgactttgacatcataccatggtta
cagatcacatcagtgttgacctctaagtacccctccatggtgcctggccaggagctggtt
cctctgctgtccgtcctgtgccagctgctgggggagcagcggcggggtgacagggggccc
tacgtgctgcgctgcatgagggaggtggctcgctgccaggccacacacccagagagggcc
caatcctacagggctgaactgggcaggctgtggggccgtgtctgggtcctggctctacgg
ggggtcagctccccccagactgaggccctcagtctggccctgctgtccacaatcctccag
ggagccttcattcccattgacagagagctctggaagctcttctctggctcagcctgcaag
ccctctgatgctgctgctctgtgtttggcccaggcccttctcaagtgtcctgttcttaag
agcctgggccctgggtgggaccatgcaggggccgtggagggggtcgggccacccagcctc
aaggagaacatcatgagctggctgctgatgaacgaacagagtgaagaggcagaggagagc
tcaagaccacaccccatcatctgcagggattttcctcataacctaatccccagaatcctt
gtgcctttgaccctcaaagacacccgagctggcattatgtttctccttggggcaaaggga
cttgagagtgctgtgatgcaagatcaagcacaagtggaagttaaaggtgccctgagtgag
attgagagcatgtacctgcagttcagctttgacgagatgccctctaaccccatggtgaaa
gtgatggggtcctcagccggcactcagctcactgttgtccccagccttaaacacaagctg
gagcagggcctcttgtctgtggctgaccacctactcaactgctactccccagattctcag
tccacaccaccagaatgcctggttcgttgttcaagtctccttactggcgttttagcagga
tatgtctctactggtctcctgactgaggaagaagcctgccattcccaactcttcctaaag
gccaaggcactggtccaggattttagtgagtacatatctaatgtgaaggtgaagatggca
gaggatgggacaatgaccacactcaggtctgtcatgcggctgtgcacacagtgtgtcaaa
agaggggttaaggacagtatgagctctgtttcttgcaacttgttcatgaagattttccct
gcgagacttttgactgaactggcagaaatatgcaaactgttgctgaacagctcctgtaag
agaggtagtgtggggattgaggaggagaccacagatgaggactgggacatgacgaggaca
caagctgaccagcaggaggacattgacctgtttgatgatggagacggaccacagaccagc
acatctaaggggactcacagacagaatgtggaccccaatgacacccagtgtggtcctgat
gctaaaagcctcctggctgaggagcatttggcccagcaggatttagccatcttggccagt
ctggagttcctgtccctgtgtgtatcggctgagtttatccatgggctctctttcaaacca
gtggaggtccgccgcaagttactactgctgctggagcagatagactgcaccaagccacta
caccttaacatgtacctggtccttctgaagaaactacctgctgaggacacatcgctggca
gctgaagagtttgactcactcctcagacctctggcggatctttgctcattgtaccgccag
gaccaggagatctgtgctgcagtgctgctgggtctgctaccgtctatccgtagtctgggc
cgtactcaggaccagcagaatgacatgagacatgtacagggagctctgctccaagtggtc
tctggattctgcattttgggcagaacggggaaatgcacagcaattgtaaaggtggcatta
attcactgtctactggctctactggaggctgacccttgctgtaagtgggcggtccttacc
ctgagggaggaggagcttccagtgtccgtcatcctcccgtcccacctgtctgactctcac
catcacgtacgaatgcttgcagccatgacagtggagaggctgtttttggagatgacaccg
gacagcttggagaagagaaagatgcttcctctgaaatgccagcagacagcctttgagaac
gtctacctgaaagcccaagaagggatgagggtccagaagaacagctctcctgaagacctg
agtgacgagacctttaaccgcaaggccacgctgctgaagagtgtgtcggtggtgctgtgc
tgcagccccgtctgtgagaaacagtccctcttcgccctcttccagtcctacaaggagaac
aacatagaggagccgctcatcaaaaaggtcctgggcagtgtgtccagagctctgggctac
aggagtgtggaggggtttgtcagctctcacctggattacctggtggcagagtggctgggc
cagcatggctacactctggagtccttcccatacactctgctcaaccacgccactctcaag
gacttctacagctcctcctatcaggtccttatcccacacctggtcttcctggatgacttt
aagcaggtgaagtccatcagcacccacctgggtaaggactggaagaagctgctggccaac
tgcttccctaagatcatggttaacatcctgccctactttgccgtgtcgggccaggatgcc
caagtggcccagcagagagagaaggcccacagggtctatgacctactcaaggacagcaac
tgcctgggcaaaccgcaaatcgacagcctgattcacagtaacctgtcagacattgtggtg
gagctgttgatgaccctgtatgaaggggctgctactgaggagggggggagaggggacctg
agaaggttcataggggaactggacccagccccaaacccaccctatttcagctcctatgtc
ataaaagccacactggactatctcagctcgtgtcacagtgccaatctcaagtccctggtg
gccattttatccaagactccgatctccatccagaggatcctactggcggtgtgtcagaag
gcagctgagacaatcaatgcctacgaaaggcaccgcatcctgctgatgtactacctgttt
gtcagcctgctgctcaaggaggtcaaggacggcctggggggagcctgggcctttgtcctc
cgagacataatttacacactcatccaccacatcaacagcaggccggcccagttggacgag
gtgtccggccgtagtttctccctgtgttgtgacctactgacctctgtgtgtcgcacggcc
gtgcaattctgtgatgacgctgtggagagccacctacaggtcattgttggtactctcact
gcccaggtgacaaaccaacttgctatctcacagcaggtgctcagtctgttgaagttcctg
gtcgtagagagtcaggacaagctaaagagtgccatccagaagttagaacctttcccagac
cgacctgagttcagagagctgagggccgtgcagcacacactgaagtacagcacagggaaa
ttcactctcagacaggagatagcccacttcctgtctgtggcttcctgtgactccctgcct
ctgactagactggaggggctgaaggacctgaggagacagctccacaacaacaagagccag
atcagaccgctgctgagagagtgcctcgcggaccctgcagagagtgtgttggtgctgctg
gtccttaacctactacagctctgtaagctagcagccaatcaccctggaggaagagacatc
ttagaggctgcagggagctgtctgggagagctggggcctgtggatttctccaccatcgct
ctgctccatgggaaggaccagctcagtgccagagctgtatcactcttccctcaaatggaa
ccacagtggctgtacatcatcctgaactgcatcaacaatgccctcactcaccactgtatt
gaggtgaggcaagctgctgtccagagtctgaaggacatcttggccactcaggctggagct
gacttctgggagatccataaagacaaccgtgaccccatgctggtttacctcaaccctttt
agatctaccaagaagaaggttgggcagacttttcaagacctgaaatatcacatcctcgtg
gtcgggatgagtgatgaggtgagcttggtggctagggagcggctggagagccaggacctg
tgggtgcctgaggctggcggccataaggcctggttgaagacgctctgcatggttctgctg
gacagtggaggggtcaggagtgaggctctgctgctttcccggcccatgtgtctggtgaaa
acagacttctgccagagggtgctgccgctcatcatccatgacatcctgctgggggactct
gacggctcctggaggaagctcctctccacacacatccaggactttttaaccagctgttcc
agtcgtgcccgggcctccagccgctccaccactcctctcccctcagactctgcaggagag
tcggacatctccaaccagggtccgttggataaggcctctctgcgcaccatgctctctgtc
attaactatctgaggcagcaacaaagacctctagaatctgatagtaacttgtgtggtacg
gtgtgccactctaacttctggttggagctgaactacctggaggtggccagggcggcccag
tcctgctcagcacacttcacagccctgctctactctgagatctatgtagacaagatcaag
actaacatggaggagaaccgcagaaatccggccagagcgtcacgcagaatcacatttgat
gagagcagtcagaacttcgccatctccagtctgacagaggagagtgtgaaagacactggt
atcagtctacaggacctactgattgaggtgtatcgtagtattggggagccagacagtctg
tatgggtgtggaggtgggaagatgaccagcgctctcaccaggattcggacctatgagcat
gaggcgatgtggggaaaggcactgacctcctacgacctccactccaatcttcctgatggc
acacggcaagtgggcattgtggagggtctgcagaacattggtctgagcagtatcctggcc
acctacctgcagggtctggagagtgggggggtggagtggggggcggagctaagggagctc
aggtttcaggctgcctggaggaacatgcagtgggactgtgacctatcagagcggaatgag
aaattgaaccctggcttcaacgagtcagtgttctgctccctgcaggctttgagagacaaa
gaattttccacattcgatcaaactcttaaatatgccagaggcaatgaggtggaggaactg
tgcagaggcagtctggaggcagtgtcctctctctaccctgctctacggaacctccagagg
atcagtgagctagagagcatccgacaactcttctccaagcccctgaccgaggtaggcctg
gccgaggtgtgttcccattggcagcagcactcccagctgctggtggacagtgactttacg
ctggtggagcccatcctggccctgcgctccgtggcccaggagaccctaatctcccaggag
agagaccctgaaaagaacaagtacctcagcactgtcctcacctcccacctcatggagctc
tgccaactggcccgcgccgcaggaaacacacagctggcagagcgggcagttttccagatg
aagcagcatggcggaggaggggggcggggctccacagcgtcgtcatggcagctggaggag
gcccaggtgttttgggcgaagggagagcagggtcttgctctggggctactgagacagatg
atccacactctggaggagcaggttttgtttaaccctgccctggtgccggtgttcacggag
tgcctgaggctgtgtgggaactggctggcagagacgtgcctggagagccctggggtcatc
ctggagaagtacctggagagggcagtggaggtgatcgagggccatgcgataggttcagac
accaagctgcagagccagaggacgcaggccttcctgtccctggccaggttctcagatgcc
cagtaccagggcattcataactacatgaagtcatctgagtttgagaacaaacaggctctg
ctggtgaaggccaaggaggaggtggacttgatgagggagcgcaaggtcagcaccaacagg
tacacagtgaaggtgcggagggagttggagctggatgagagggctctgtccaacctgcag
gctgacagaaggaggttcctgtgtaaggctgtggagaactacatccattgtctggagcag
ggtgaggagcacgacacctgggtgttccgcctggcctcactgtggctggagaacgctgac
gtcaaggcagtcaacgacatgatgaagggaggtgtgcacaggatcccgtcctataagttt
ctgcctctcatgtaccagctggctgcccgcatggggaccaaaatgtctgctacagtggca
gaggatgtgggcttccatggtgttctcaatgagctgatctgcctgtcgtgtctggagcac
cctcaccacaccctcttcatcatcctggctctggtcaacgctaacaaggacgagagcctc
tcccgcagccgcctgtccaagagcaccccgcgccattcctcccaactggacctggagcgg
tcagaggtgtcccagagggtaatgaacaagatcaggaagaagagagcccagatgatcaga
ggcatagaggtcctctgtgatgcctacatcactctggcctacatggacgccagtcgacac
aagacagagaaaaaagccatcctcatcccctctgaccagcccatcatgcagataaagaac
ctagatgatgtcatcattcctacaatggagatcaaggtggacccctcgggtaaatatgac
aacctggtgaccatcaagtccttcaagcctcactttcacctggccggaggggtcaacctg
cccaagatcattgagtgtgtgggatcagacgggaagagcagacgacaactggtcaagggc
caggatgacctgcggcaggatgctgtgatgcagcaggtgttccacatgtgttctatgctg
ctgcagcgcaacaccgagacacgcaagaggaaactcaacatccgacgctacaaggtggtg
cccttctcccagcgtagtggggttctagagtggtgctcggggaccatccctataggggat
ttcctcatagacccccaaaagggcgctcacacacgcttctgccccaaagactggaccagc
ataacctgccggaaaaagatgatggagtctcagaggcttggttccagtgggacgacccag
gctttcagtgaggtgtgtcagaacttccggcctgtcttccggtacttctgcatggagcga
ttcctggacccggcagtgtggctggaaaaacgtctggcctacactcgcagtgtggccact
tcctccatcgtgggctacattgttggactgggggacaggcacattcagaacatccttata
gacgaacagacagctgaactggtgcatattgatttgggtgtagcgtttgaacagggcaag
attctcccaactcctgagactgttcccttcaggctctccagagatattgtggatgggatg
ggcataacaggggtggagggcgttttcagaagatgctgtgagaagaccatggaggtcatg
aggagttctcaagaggccttggtgactattgtagaggtactgctgtacgaccctctgttt
gactggaccatgaaccctctcaaggccttctacctgcagcagcagcatgatgagcaggct
gagctccaggccacgctcaactctacactggggggagacatcctggaggcccaccccaag
tccagcagtgatagccagagcttcaacaaggtggcggagcgcgtgctgctgcggctgcag
gagaagctgaagggggtggaggatggcagggtgctcagtgtaggagggcaggtcaacctc
ctcatccagcaggccatggaccctaacaatctcagccgcctcttccccggctggcaggcc
tgggtctag

DBGET integrated database retrieval system