KEGG   Salmo salar (Atlantic salmon): 106613210Help
Entry
106613210         CDS       T04363                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00052  Galactose metabolism
sasa00500  Starch and sucrose metabolism
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106613210
   00500 Starch and sucrose metabolism
    106613210
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     106613210
    3.2.1.20  alpha-glucosidase
     106613210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 DUF1410
Motif
Other DBs
NCBI-GeneID: 106613210
NCBI-ProteinID: XP_014070717
UniProt: A0A1S3T297
LinkDB All DBs
Position
ssa09
AA seq 1817 aa AA seqDB search
MGNRKFSGLEVTLTVLFLLVTTAAVALVVLMATGEPAVIKDETTDIVDPVCPVIPLGERV
DCFPDAGASKLGCLQRGCCWSPLDERNAPWCFFSTNHGYSVVREEKPNSYSLSALLKKKA
APSLFGEDIEELTFHADMQTVNRLRFKISDAHKKRFEVPHEHIKPPATHPSGSFNYEVEL
THNPFGFQVRRAATKKVLFDTTMGPLVFADQYLQLSARLPSHNIYGLGEHVHQNYRHDTN
WRTWPIFTRDSFPNGGTHNLYGHYPYFLCLEDESGKSFGVFLMNSNAMEVTLQPAPAVTY
RTIGGVLDFYILLGDTPEQVVHEFLELIGKPMIPPYWSLGFQLSRWDYGSLDEVKKTVER
NRAVDLPYDIQYTDIDYMEDKKDFTYDEVNFKDLPQFADYMHEKGQKYILILDPAIAISR
RINGPYEAYDRGTQKNAWVTEADGITPLLGEVWPGVAVFPDYTNPSCKEWWTDEYVRLSK
EIKHDALWIDMNEVSNFMKGSIKGCDDNNLNYPPFTPSILDGVLYSKTLCMDSKQTWGNH
YDVHSLYGYAMVLATKDALERVFEGNRSLMLTRSSFPGVGKYSGHWLGDNAANWNDIKWA
IPGMLEFGLFGIPYIGADICGFFDDVSEELCRRWMQVGAFYPFSRNHNAQHYKPQDPAVF
GADSLLLNTSKHYLNIRYTLLPYLYTLFYKAHTTGDTVVRPVMHEFYSDSNTWTVDRQFL
WGKHLLITPVLDPGVEWIQAYVPDAVWFDYETEERITVRKQQVEMYLPADKLGLHIRGGA
ILPIQRPAVTTVYSRLKPMGLIVALDDNNRAAGELFWDDGDSRDTVETGNYMHYQFSFNN
GELTIQVMHSGYSDANNLKFENITVLGVSSPPVTVNVTHNNNNIVISTFKYDTVKQVLYL
RDLNLTLGQNYTVRWDQVRDPVPERFDCYPEPDSDETKCRARGCIWGTSTNEGVPWCYYP
EDYGYTATTVIEQPSGWSFDITRNAGFRSSGRPESPDINSLRVEIKYHSADLLQFKIYDP
TNKRFEVPVPLNVPSTPETDETKRLYIVQVKKQPFGIQVIRKSTGTLIWDSALPGFTFSD
LFIQVSTRLSSDYVYGFGETEHTSFKHDLNYHTWGMFAKDQPPGYKMNGYGVHPFYMGLE
TTADAHGVLLLNSNAMDVTFQPTPALTYRTLGGILDFYIVMGPTPELVVEEYTALIGRPV
LPAYWSLGFQLCRYGYANDTEIADLYREMRAAGIPYDVQYADIDYMERQLDFVLDSQFQG
LPALVDHMRGEGMRFIFILDPAICANETTPYSAFDRGVEEDVFIKWPKELSNDIVWGKVW
PDFPGVVVNESVDWDTQVEIYRSYTAFPDFFMNRTATWWHREISDFYTKTMKFDGLWIDM
NEPSSFVHGTVGEKCLGPPVYDNPPYMPPLESRHRGLNHKTLCMNSQQHLSDGTPVKHYD
VHNLYGWSHTKPTYDALLSVTGKRGIVVTRSTYPSSGKWAGHWLGDNNSSWDQLYKSIIG
MMEFSLFGFSYTGADICGFFNPAQYEMCLRWTQLGAFYPYSRNHNGKFNPRQDPVSWNAS
FSEASRHVLNIRYTLLPYLYTLMFYAHSEGSTVVRPLLHEFVSDRKTWDIHRQFLWGPAL
LISPVLDEGAREVEGYVPDDLWYDFHTAKAVGVKGQMVTMPTPLDHINLHVRGGHILPWQ
KPENNTHYSRKNPMGLIVALSDSGTAHGSLFWDDGEGIDTYASKQYLHNSFTVASNTLTC
HVMFSGLPVTERLTLGVVKVWGVGSVPVTEVTIRDISGSIKNVTLQHNIITEELIADATD
LSFRMDQGFTLMWKTNT
NT seq 5454 nt NT seq  +upstreamnt  +downstreamnt
atggggaatcggaagttttcagggttggaggtgactctgacagtcctattcctgctggtg
acaacagcggctgttgctttagttgttctaatggctactggggaacctgcagtcatcaaa
gacgagaccacagacatcgtggatccagtatgtcccgttattccactgggggagagagtt
gactgtttccctgacgccggtgcatctaagctggggtgtctgcagcgaggctgttgttgg
agtccattggacgagagaaacgctccatggtgcttcttctccaccaatcacggctactct
gtggtccgcgaggagaaacccaacagctacagcttgtcggcccttctgaaaaagaaggct
gccccctctttgtttggagaagacatagaggagctgactttccacgctgacatgcagaca
gtgaaccgactgagattcaagatctcagatgcccataagaagcgatttgaggttccccat
gagcacatcaagccccctgctacccatccctctggatcctttaactacgaggtagagctc
acacacaaccccttcggcttccaagtacgcagggcagccaccaagaaagtcctgtttgac
accacaatgggtccgctggtgtttgctgatcagtacctgcagctgtctgccagactgcca
tcccataatatatacggtctgggagaacacgtccatcagaactaccgtcatgacaccaac
tggagaacgtggcctatcttcacacgagattcattccctaatggagggacacataacctc
tatggtcattatccctacttcctttgtctggaggacgagagtggcaagtccttcggagtc
ttcctgatgaacagcaatgctatggaggtgacgctgcagccggctccagcggtgacctac
agaaccattggaggagttctggacttctacatcctgctaggagacacacctgaacaggtg
gtccatgagttcctggagctgatcggcaagccaatgattcctccatactggtctctagga
ttccagttgtctcgttgggactacggcagtctagatgaagtcaagaaaacagtggagaga
aaccgagctgtcgacctgccatatgatatccagtatactgacattgactatatggaagat
aagaaggacttcacttatgatgaagtcaatttcaaagacctccctcagttcgctgattac
atgcacgagaagggacagaaatacattctcatattggacccggcaatagccatcagtagg
aggatcaacgggccgtatgaggcctatgaccgaggaacacagaagaacgcttgggtgact
gaagctgatgggataacacctctattgggagaggtctggccaggtgtggcagtgtttcca
gactacactaaccccagctgtaaagagtggtggactgatgagtacgtcagattatcaaaa
gaaatcaaacacgacgctctgtggattgatatgaatgaggtgtctaacttcatgaaaggc
tccatcaagggatgtgatgacaacaatctcaactaccctcccttcactcctagtatcctg
gatggggtgctgtacagtaagactctgtgtatggactctaaacagacctggggaaaccac
tacgatgtccacagtctctatggatacgccatggttctagccaccaaagatgctctagag
cgtgtgtttgaggggaacaggagcctgatgctgacccgctcgtctttccctggagtgggg
aagtactccggccactggctgggtgacaacgctgctaactggaacgacatcaaatgggcc
atacctggcatgctggagtttggcctgttcggaatcccttacattggtgctgatatttgc
ggtttctttgacgacgtgtcagaagagttgtgtcgtcgttggatgcaggttggcgcattc
tatcccttcagccggaaccacaacgcccagcattacaagccccaggacccggcagtgttt
ggtgcagactctctgctgttgaacacctctaaacattacctgaatatccggtacaccctt
ctcccctacctctacaccctcttctacaaggctcacactaccggggacaccgtggtccgg
cctgtcatgcacgagttctactctgacagtaacacctggacagtggaccgccagttcctc
tgggggaaacacctgctcatcacacctgtactggaccctggggtggagtggatccaagcc
tacgtcccagacgctgtgtggtttgactatgaaacggaagagcgaataacagtccgtaag
cagcaagttgagatgtacctgcctgcagacaagcttggtttacacatcaggggcggagct
attctacctattcagagacctgcggtcacaactgtttatagtcggcttaaacccatgggt
ctgatcgttgcgctcgatgataacaacagagcagcaggagagctattctgggatgacgga
gactctcgagataccgttgaaactggcaactacatgcactaccagttctcttttaacaat
ggcgagttgaccatccaggtgatgcattctgggtacagtgacgcaaacaacctgaagttt
gagaacatcaccgtgttgggagtctccagtccccccgtgactgtcaatgttacccacaac
aacaacaatatcgtcatatctactttcaaatatgacactgtcaagcaggtgttgtatctg
cgagatttgaatctgactctgggtcagaactacacagtgcgatgggaccaggtcagagac
ccagtgccagagcgctttgactgctacccagagcccgacagtgacgagaccaagtgtagg
gccaggggctgcatctgggggacgtctaccaatgaaggcgtcccgtggtgttactacccc
gaggactacggttacaccgctaccacggtgatagagcaaccttctggctggagcttcgac
atcacgcggaacgctgggttccggagcagcggaagaccagaatctccagacataaactct
ctcagagtggagatcaaataccacagtgcagacctgctgcagtttaagatctatgaccct
acaaataagcgatttgaggttcctgtcccccttaatgtcccctccaccccagagacagat
gagactaagagactttatatcgtccaggtcaaaaaacagccttttggcatccaggtcatc
cgaaagagcactggcacactaatatgggactctgcgttgccaggctttaccttctcagat
ctgttcatccaggtgtcaacacgtctgtcttcagattatgtctatgggtttggagagaca
gaacacacctcattcaaacacgatctcaactatcatacctggggcatgttcgctaaggac
cagcctcctgggtataagatgaatggctatggtgtgcatcccttctatatgggtctagag
acgaccgccgatgctcacggtgtactactgctgaacagcaacgctatggatgtgaccttc
cagccgacccctgccctgacctatcgtaccctggggggaatcctggacttctacattgtg
atgggacccaccccagagctggtggtggaggagtatactgccctgattggacgtcccgtg
ctccctgcctattggtcccttgggttccagctctgtcgctatggatacgccaatgacaca
gagatagcagacctctacagagaaatgagagcagcaggaataccctacgatgtgcagtat
gcagacatagactacatggagcgccagctagactttgttctggatagccagttccagggt
ctaccagccctggtggaccacatgagaggagaaggcatgagattcatcttcatactggac
cctgccatctgtgccaatgagacaacaccctactctgcctttgaccgtggtgtagaagaa
gacgtattcatcaaatggcccaaggagctcagcaatgacatcgtctgggggaaggtatgg
cctgacttccctggtgttgtagtcaatgagtctgtagactgggacacgcaagtagagatc
tataggtcctatacggcattcccagacttcttcatgaatcgtacagcaacgtggtggcat
agggagatttcagatttctacactaaaaccatgaaatttgatggactctggatcgacatg
aacgaaccatccagcttcgtccatgggaccgttggagagaagtgtctgggtccccctgtc
tacgacaaccccccatacatgccacccctggaatccagacaccgtggtctcaaccataag
actctgtgcatgaacagccaacagcacctcagtgatggtaccccggtcaaacactatgac
gtacacaatctgtatggatggtctcacacaaaacccacatacgacgccttgctgagtgtg
acaggcaagcgggggatagtggtgaccaggtctacctacccctccagtgggaagtgggct
ggacactggctgggagacaacaactccagctgggatcagctctacaagtcaatcatagga
atgatggagttcagtctgtttggattttcttacactggagctgatatctgtgggttcttt
aatccagcccagtatgagatgtgtcttcgctggacgcagcttggtgcattctatccttac
tctcgcaaccacaacggcaagttcaaccctagacaagaccctgtatcgtggaatgcatcg
ttttctgaggcttctcgtcatgtgttgaatattcgctacactctccttccctacctctac
acactcatgttttacgcccacagcgaaggaagtacagtggtccgaccgctgctgcatgag
tttgtgagtgacaggaagacgtgggacatccacagacagttcctgtggggccctgctctg
ctcatcagcccggtcctggatgagggggccagagaggtagagggctacgtcccagacgac
ctctggtatgacttccacacggccaaggctgtaggggtgaagggccagatggttaccatg
ccaacacctctagaccacatcaacctccacgtgagaggaggacacatcctgccctggcag
aaaccagagaacaacacacactacagtcggaagaatcctatggggctgatcgttgccctg
agcgacagtggaactgcacatggttccctgttctgggatgatggggaggggattgatacg
tatgcgagtaagcagtacctacacaactcgttcacagttgcttcgaacaccctgacctgc
catgtgatgttcagtggtctgccggtcactgagaggctgaccctgggtgtggtgaaggtg
tggggggtcggtagcgttcctgtcacagaggtcaccatacgagatatatcaggctcaata
aaaaacgtcacccttcaacacaacatcatcactgaggagctgattgctgatgccactgat
ttatcattccgcatggaccagggcttcacgctcatgtggaaaaccaacacctaa

DBGET integrated database retrieval system