KEGG   Syntrophus aciditrophicus: SYN_00412Help
Entry
SYN_00412         CDS       T00346                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00473  D-Alanine metabolism
sat00550  Peptidoglycan biosynthesis
sat01100  Metabolic pathways
sat01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SYN_00412
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SYN_00412
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SYN_00412
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sat01011]
    SYN_00412
Enzymes [BR:sat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SYN_00412
Peptidoglycan biosynthesis and degradation proteins [BR:sat01011]
 Precursor biosynthesis
  Amino acid ligase
   SYN_00412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 RimK CPSase_L_D2 ATPgrasp_ST FerI
Motif
Other DBs
NCBI-ProteinID: ABC76865
UniProt: Q2LS09
LinkDB All DBs
Position
1023515..1024582
Genome map
AA seq 355 aa AA seqDB search
MESQNETKLRVGIIMAGLSSEKEVSLESGRNIFSKIDRRKYSPIPIFMDSDAALWEIPLK
LLMRNCTRDVEEDLAEEAVRVPYEELKTRVDLVFLALHGKYGEDGCMQGLLELLKIPYTG
SGVLASALGMDKLASRRVLEINGIDVPRTVPVFRGAWKPEEENALFERIEQEIGFPCVVK
PSREGCSTGVKKVMSRAGLSDALNGAFLWDCTALVEEFIDGMEVTCGILGGNPPTALTPS
ETIATSDVLSLEDKFLYGQGENKTPARLPGETLMKIQEVAVKAFEALDLKGYARIDMFVT
SAGRVLVLEPNTQPGMTPSTVLFHQAAASGITQTGLVDRILEAALSVHAGKKGPL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagtcaaaatgagacaaaattgcgcgtaggcatcatcatggccgggttgtcctct
gaaaaagaggtgtccctggagagtgggcggaatatcttcagcaagattgaccgccggaag
tacagccccatccccatcttcatggacagcgatgccgccctgtgggaaatacccctcaag
ctgctgatgagaaactgcacccgtgatgtcgaagaggatctcgccgaagaggccgtgcgg
gttccttatgaagagctcaaaacccgggttgatctcgtttttcttgctctgcacggcaag
tatggcgaggatggctgcatgcaggggttgctggagcttttgaaaatcccctatacaggc
tccggcgttcttgcctctgcgctgggaatggataagcttgccagccggcgggtcctggag
atcaacggaatcgatgttccccggacggtcccggttttccgcggcgcatggaaaccggag
gaggagaatgccctttttgagcggatcgaacaggaaatcggttttccctgcgtcgtcaaa
ccctctcgggaaggatgcagcacgggcgtgaagaaggtaatgtcccgggcagggctttcc
gatgccctcaacggtgcttttctctgggattgcacggccctggtggaggaattcatcgac
ggcatggaagtgacctgcggcattctgggcggcaatccgccaacggctttgaccccgtcg
gaaaccatcgccacatctgatgtgctttcgctggaggataaatttctctatggtcagggg
gaaaacaagaccccggcccgccttcccggggaaaccctgatgaagattcaggaggtggcc
gtaaaggcctttgaagcccttgatctgaagggttacgcccggatcgatatgtttgtcaca
tccgccggccgggttctagtgctcgaacccaacacccagccgggaatgacgccgtccacc
gttctcttccatcaggccgccgcatcgggaataacccagaccggactggttgaccgaatt
ctggaggcggctctttccgttcacgccggcaaaaaaggaccgctgtaa

DBGET integrated database retrieval system