KEGG   Syntrophus aciditrophicus: SYN_00879Help
Entry
SYN_00879         CDS       T00346                                 

Definition
(GenBank) glycogen synthase/glycogen phosphorylase
  KO
K16153  glycogen phosphorylase/synthase [EC:2.4.1.1 2.4.1.11]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00500  Starch and sucrose metabolism
sat01100  Metabolic pathways
sat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SYN_00879
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sat01003]
    SYN_00879
Enzymes [BR:sat01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     SYN_00879
    2.4.1.11  glycogen(starch) synthase
     SYN_00879
Glycosyltransferases [BR:sat01003]
 Polysaccharide
  Storage polysaccharide
   SYN_00879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn DUF3417 Phosphorylase Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_5 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ABC76722
UniProt: Q2LRL2
LinkDB All DBs
Position
865521..869777
Genome map
AA seq 1418 aa AA seqDB search
MAENQNGYLFECSWEVCNKVGGIYTVITSKIREAMKAYGENYYLLGPDLKTNLDFEETDE
ECWFKVREGTAIKDIPCRFGRWKIPGEPKVILVNFGMKYNKDQLLYKLWEDYGVDSIAGG
WDYTEPVMFSYACGEVIETIYNLMVRPHGGTAIAQFHEWMTGAGLLCLKKSVPEIGTVFT
THSTILGRTLAGSGVDIYASMDHISPLREANAHSITAKYSMETAAAREAGCFTTVSEITA
LEAKNFLGRYPDVITPNGLDIEQIPNLVQDRRPAMRSRMRLLKAASRFLKKDLPSDTKIL
AISGRYEFHNKGIDVFLDALGRLEKEMKGDQTLLVYLFVLGGHTDLIPALQSDYAKVETG
NPPICTHRLHYEASDPILETSNRLGLKNLPQNRINIIFIPAYLNGHDGLINMSYYEALSG
CDLGVFPSYYEPWGYTPQESAAHAVPTISTDQAGFGLWVQSTFKEHSGVIIMKRKGREIQ
TITNDLFDILKNFLSWTDADMQLRRESAWTIAVQANWGEFYKFYAAAYDRAAGIAREYAE
KLALFDYRTAYRRTFAGAVTTQPHFRRFTAVAKLPQEIARLRELAYNLWWSWNSRALELF
ASLDPQLWTDMGNNPVRMLETVSAERLIEAKNNAIYISLYESVMKQFDDYMADKTLCRRL
SVSPEIKWSSPVAYFSTEYGLHESLPIYSGGLGVLSGDHIKTASDLNIPLVGVGLLYRSG
YFKQVIDKNGVQIAEYPECDFSNMPLQIVQDEKGDEVQISLELPGRTLYANIWELQIGRL
SLYLLNSDVPGNTPQDRKITGRLYPADQRTRIEQELLLGAGGIRLLRKLGIKPSLYHINE
GHSAFLVFSRIQLLMTEEGLSFDEASEVVRGSTIFTTHTPVEAGNERFDKDLIEYYFANF
IKWSGISWSQFWDLGLKEAGDDKPFYMTVLGLKMTHLSNGVSEIHGQVARRMWRDVWKGF
HELDIPIRQVTNGVHMASYIAPRMKELFDIYLGRGWQRSITDPEIWKKVWDIPDAMLWRT
RYELKQRMINYLRDHISKHWSRYGYSKTWREEIYSKMNPTALMIGFARRFAPYKRADLIL
SDLDRLDKILNHPTRPVHLVFAGKAHPNDEMGKSLIKKVVSVCNQEPFRGKIFFLEDYDI
RVARHLVQGVDVWLNTPRRPYEASGTSGEKVVFNGVLNLSISDGWWAEGYDGTNGWTIGP
LVRGLSEEDSSVDEEDSLSLFSTLENSVIPLFYDRDTSGIPDKWITMIKRSIHTLAPRFN
TERMLQEYYNDMYIPTVRRIGELSEKSYRLAKEIAEWKSTIPMRFSSLRLLDISVEGIQG
DTIVVDQPLVVTARIDPGKLKPEEIYAELFIGRDDGYGFLEKPDCVPLKMITNLLNGSLI
FTAEYRVRRNGPHSYGIRVLPYNEKLASKHETGLILWG
NT seq 4257 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaatcagaacggctatctctttgaatgcagttgggaggtatgcaataaggtt
ggcggcatctatacggtgattaccagcaaaattcgggaggcaatgaaggcttatggggaa
aattactatctcctaggaccggatctcaaaactaatctcgattttgaggaaaccgacgaa
gaatgctggttcaaggtccgtgaaggaacagccatcaaggacattccctgccgtttcggg
cgctggaagattcccggtgaacccaaggtcatcctggtcaacttcgggatgaagtataat
aaagatcaacttctttacaaattgtgggaagattatggcgtggactccatcgcgggtgga
tgggattatacggagcccgtcatgttcagttacgcctgtggcgaagtgatagagaccatt
tacaatctcatggtccgtccccacggaggaacggctatcgcccagtttcatgaatggatg
accggagccggacttctctgtctgaaaaaaagtgttcccgagatcggaaccgtctttaca
acccattcgactattctgggaaggacgctggcgggatctggagtggatatttatgcttcc
atggatcacatctcccctttgagggaggccaatgcgcatagtattactgcaaaatattcc
atggaaacggctgcggcccgggaagctggctgctttaccacagtcagcgaaattaccgca
ctggaggccaaaaattttctcggtcgttatcctgatgtcattaccccgaatgggctggat
atcgaacagatcccgaatctggtccaggatcgccggccggccatgcgctcccggatgcgg
ctcctgaaagccgcgtcccgctttctgaagaaagacctgcccagcgatacgaagattctg
gcaatatccgggcgatatgagtttcataacaaggggatcgatgtctttctggacgctctc
ggccgtctggaaaaagaaatgaaaggcgatcagacccttctggtttatctttttgttctg
ggcggccatacggatttgattccggcgctgcaaagcgattatgccaaggtggagacggga
aatcctcccatttgcacccatcgccttcattacgaagcctccgacccgattctggaaaca
agcaaccgtctgggtttgaaaaacctgccgcagaacaggatcaatatcattttcattcct
gcctatctgaacggacatgacggcctgatcaatatgagctactatgaagccctttccgga
tgcgatctgggtgtctttccttcatactatgagccttggggatatacgccacaggaaagc
gccgcccatgccgttcccacgatctccacggatcaggcgggcttcgggctctgggtgcaa
tccacattcaaggagcacagcggcgtcatcatcatgaaacgaaagggaagggaaatccag
acgataaccaatgacctcttcgatattttaaagaatttcctgtcctggacggacgcggat
atgcagctgcggcgagagagtgcctggaccatcgcagtgcaggcaaactggggggaattc
tataagttttatgccgcggcatatgacagggcggcaggcatcgcccgggagtacgcggag
aagcttgccttgttcgattaccggacggcctaccggcgcacctttgccggcgcggttaca
acacagcctcatttccggcggttcacggccgttgcaaagctgccccaggaaattgcccgc
ctgagagaactggcctacaacttatggtggtcctggaattcccgggcccttgaactgttt
gccagtctggatccacaactctggacggacatgggcaacaatccggtccgcatgctggag
accgtatcggcggagcggctgatcgaggcgaaaaacaacgccatatacatcagcctctat
gaatcagtcatgaagcagtttgacgactacatggcggacaagactctctgccggcggctt
tccgtttcaccggagataaaatggtcttcgcctgttgcttatttctctacggaatacggc
cttcacgaaagtcttcccatttattccggagggcttggcgttctttccggagatcacatc
aaaacggccagtgatctcaatatccccctggtgggcgtcgggttgttgtatcgaagcgga
tatttcaagcaggtgattgacaaaaacggggtccagatcgcggaatatccggagtgcgac
ttttccaacatgcccctgcagatcgtccaggatgagaaaggggacgaggtgcagatttca
ctggagcttcctggacggaccctctatgcgaatatctgggagctgcagatcggccggttg
tctctctatctgctcaattccgatgtgcctggcaatacgccgcaggaccgaaaaataacc
ggccgcctctatcctgcggatcaaagaacacggatcgaacaggaactgcttctgggagcg
ggtgggatacgacttctgcggaaactcgggattaaaccaagtctctaccacatcaacgaa
ggccattccgcgtttcttgttttcagccggattcagcttctgatgaccgaagagggattg
agttttgacgaggccagcgaggtggtccggggcagtacgatctttaccacgcataccccg
gttgaagcaggaaacgagcggttcgacaaggatctgatcgaatattatttcgcgaatttc
atcaaatggtctggcatatcctggtcacagttctgggatctggggttgaaggaggccggt
gatgataaacctttctatatgaccgttctggggctcaagatgacgcatctgagcaacgga
gtcagcgagatccacggccaggtggctcgacgcatgtggcgcgatgtctggaaaggattc
cacgaactggatattccgatccggcaggtgaccaatggggtccacatggcttcctatatc
gctccgaggatgaaggaactttttgacatttatctgggacggggctggcagaggtccatt
accgatcccgaaatctggaagaaagtctgggatattcccgatgcgatgctgtggcgcacc
aggtatgagctcaagcagagaatgatcaattatctgcgggatcatatctccaaacactgg
tcacgttatggctattccaagacctggcgcgaggagatttactccaaaatgaatcccacc
gcgctgatgatcggctttgctcggcgtttcgccccttataagagagccgacctgatcctg
tccgatctggatcggctggataaaattctgaaccatccgacccggcctgttcacctggtt
tttgccggcaaggcccatcccaatgacgaaatggggaaaagcctgattaaaaaagtggtt
tccgtctgtaatcaggaacctttccgtggaaaaattttcttcctggaggactatgacatc
cgggttgcacgtcacctggttcagggagtggatgtctggttgaatacgccccggaggcct
tatgaggccagtggaaccagtggggaaaaggtggttttcaacggcgttttgaatctcagt
atttccgacggctggtgggcggaagggtatgacggcaccaatggctggaccatcgggccc
ctcgttcgggggctctcggaagaagattccagcgtggacgaagaagacagtctttcgctt
ttctccacactcgaaaattccgtgattcctctgttctatgatcgggatacctcggggatt
cccgacaaatggattaccatgatcaaaaggtcgattcatacgctggctccccggttcaac
acggaacggatgcttcaggaatattacaatgatatgtacattcccactgttcgccgcatt
ggggaactgagcgaaaagagctaccggttggcgaaagaaattgccgagtggaaaagtacg
attcccatgcggttttcttctctccgcctcctggatatcagtgttgaggggattcaaggg
gataccatcgtggttgatcagcccctggtggttacagcccggatcgatccgggaaaactg
aaacccgaagaaatttacgctgaacttttcatcggacgggatgacggctatggattcctc
gaaaagccggattgtgttcccctgaaaatgatcaccaatctgctcaacggatcgctcatc
tttaccgcggaataccgggtccgacgcaatgggccgcattcttacggaatccgcgtgttg
ccatacaatgaaaagctggcttcgaaacatgagacaggcctgatcctgtgggggtag

DBGET integrated database retrieval system