KEGG   Syntrophus aciditrophicus: SYN_01697Help
Entry
SYN_01697         CDS       T00346                                 

Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00061  Fatty acid biosynthesis
sat01100  Metabolic pathways
sat01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SYN_01697
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sat01004]
    SYN_01697
Enzymes [BR:sat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SYN_01697
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     SYN_01697
Lipid biosynthesis proteins [BR:sat01004]
 Fatty acid synthase
  Component type
   SYN_01697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ABC78865
UniProt: Q2LXQ5
LinkDB All DBs
Position
2998225..2998815
Genome map
AA seq 196 aa AA seqDB search
MTYEEFCKQGSFSLEDLLAFAYGNLVDDRPDGFDARLPAPPFLMLDRILTITSEGRQGRI
VAEQDIRLDAWYFQCHMPGDPVQPGCLCVDAIWQLLGFYCVWRGALGAGRALGCKNVSFN
GQIRPYNRCVRYEVDIRRFSHLKDSGASIVIGDAKVFVDNELITEITQAQTGVFSGIVYP
DYPKHSRNSVGGMIRS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaagaattttgtaagcaaggaagcttctctctcgaagatttgcttgccttt
gcatacggcaatcttgtagatgatcgtcccgatggctttgacgcacgtcttcctgcccct
ccttttctcatgctggatcggattctgacgatcacaagtgaaggccggcagggacgcatc
gtagcggagcaggatattcgtcttgacgcctggtatttccagtgccatatgcccggcgac
ccggtccagccgggttgcctctgtgtcgatgccatctggcagctgctcggattttattgc
gtctggcggggtgcattgggtgccggaagagcgctgggatgcaaaaatgtttccttcaac
ggtcagattcgaccctacaaccgttgcgttcgttatgaagtggatattcgtcgtttttcc
catttgaaggattccggagccagcattgtgatcggcgatgcgaaggtctttgtggataat
gaattgatcacggaaattacccaggcccagaccggtgttttcagtggcattgtttatccg
gattatccaaaacactcccgcaattcagtgggaggaatgatcaggagttga

DBGET integrated database retrieval system