KEGG   Sinomonas atrocyanea: SA2016_1227
Entry
SA2016_1227       CDS       T04286                                 

Definition
(GenBank) Isomalto dextranase
  KO
K20847  glucan 1,6-alpha-isomaltosidase [EC:3.2.1.94]
Organism
satk  Sinomonas atrocyanea
Brite
KEGG Orthology (KO) [BR:satk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SA2016_1227
Enzymes [BR:satk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.94  glucan 1,6-alpha-isomaltosidase
     SA2016_1227
SSDB
Motif
Pfam: Melibiase_C CBM_6 CBM_35 Melibiase_2_C Myco_haema
Other DBs
NCBI-ProteinID: AMM31909
UniProt: A0A126ZXM3
LinkDB
Position
complement(1282701..1284602)
AA seq 633 aa
MKNLSRRSLLAFGGAAALACTAAVEAPARAASTDLTVPTSPAPPLRLASRNSVFTRRGAG
PRYWNIYGYAFPHNAPIPEDEWKANIDWLASDLAPYGYDMACTDGWIEGSSRTTPNGYIV
TYNDSWQHDWAYWSHYLAERGMKLGVYYNPLWVHKAAVEDPSKTVVGRPDIKIADIVAPG
DFFAKNIGGNTLYWLDVTRPGAKEYLQGYVAYFKRLRVPYLRVDFLSWYENGMDANIGQV
NAPHGRANYETALAWLNEAAGEDLELSLVMPHLFDDASAELANGDLVRIDADADRGGWDR
LSGGRQGWQDAWPNWFNPFAGFTGWSHRNGRGQLILDGDFMRASTFASDDERRTMMNLMV
IAGSPLAIADTYQQIGNDAWVYTNKDVLELNQEGLVGKPLYRSATPYSVDPGSRDSERWA
GQLPDGSWAVALFNRSDSTTQTKTIDFANDLGLSGAANVRDLWAHRDLGVRTEATATLAP
HASALFRITPLKDRGATRYPAAYAAWGGGAGFNNDHAGHDGSGFVDGLAATAGSADPLVT
FAVRAPRRGEYTIRYRYANATGATSTLTVSAERADHSVVDGPRHVDFPALATWDTWGVAT
AGITLEAGDNLITLGRGRSDVGAVNLNWIELGA
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgaagaacctgtcccgacgctccctcttggccttcgggggcgcagccgcgctcgcgtgc
acggcggcggtcgaggcccccgcccgcgccgcctcgacggacctgacggtgcccacgtcc
cccgcgccgccgctgaggctcgcgagccgcaacagcgtgttcacccgccgcggcgccggc
ccccggtactggaacatctacggctacgccttcccgcacaacgccccgatccccgaggac
gagtggaaggccaacatcgactggctcgcctccgacctcgccccgtacggctacgacatg
gcctgcacggacgggtggatcgagggctcgagccgcaccacccccaacggctacatcgtc
acctacaacgactcgtggcagcacgactgggcctactggtcccactaccttgccgaacgc
ggcatgaagctcggggtctactacaacccgctctgggtccacaaggcggccgtcgaggac
ccgtccaagaccgtggtgggccggccggacatcaagatcgcggacatcgtcgccccgggc
gacttcttcgccaagaacatcggcggcaacaccctctactggctggacgtgacgcgcccc
ggtgccaaggagtacctccagggctatgtggcctacttcaagcgcctccgggtcccatac
ctgcgcgtggacttcctctcctggtacgagaacgggatggacgccaacatcgggcaggtc
aacgccccgcacgggcgcgccaactacgagacggccctggcctggctcaacgaggccgcc
ggcgaggacctcgagctctccctcgtgatgccgcacctgttcgacgacgcctccgccgag
ctcgccaacggcgacctcgtccggatcgacgccgacgccgaccgcggcggctgggaccgg
ctcagcggcggccgccagggctggcaggacgcctggcccaactggttcaacccgttcgcg
ggcttcacgggctggtcgcaccgcaacgggcgcgggcagctgatcctcgacggcgacttc
atgcgcgccagcaccttcgccagcgacgacgagcgccggaccatgatgaacctcatggtc
atcgccggatcgcccctggccatcgcggacacgtaccagcagatcggcaacgacgcctgg
gtctacacgaacaaggacgtgctcgagctcaaccaggagggcctggtcggcaagccgctc
taccgctccgccaccccctactcggtcgaccccggctcccgggacagcgagcgctgggcc
ggccagctccccgacgggtcctgggcggtggcgctcttcaaccgctccgacagcaccacc
cagaccaagaccatcgacttcgccaacgacctcgggctctccggcgcggcgaacgtcagg
gacctgtgggcccaccgggacctcggcgtccggaccgaggccacggccacgctcgccccg
cacgcctcggccctgttccgcatcaccccgctgaaggaccggggcgccacccgctacccc
gccgcctacgccgcgtggggaggcggcgccggcttcaacaacgaccacgccggccacgac
ggcagcggcttcgtcgacgggctcgccgccaccgcgggcagcgccgaccccctcgtgacc
ttcgccgtccgggccccccgccgcggcgagtacacgatccggtaccgctacgcgaacgcc
accggggccacgagcaccctgaccgtctccgcggagcgggccgaccactcggtggtcgac
gggccccggcacgtcgacttccctgcgctcgccacgtgggacacctggggcgtggcgacc
gccgggatcaccctggaggccggcgacaacctcatcacgctcggccgcggccgctccgac
gtgggcgccgtgaacctgaactggatcgagctgggcgcctag

DBGET integrated database retrieval system