KEGG   Sinomonas atrocyanea: SA2016_2793Help
Entry
SA2016_2793       CDS       T04286                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
satk  Sinomonas atrocyanea
Pathway
satk00564  Glycerophospholipid metabolism
satk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:satk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SA2016_2793
Enzymes [BR:satk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SA2016_2793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 Pyr_redox 3HCDH_N DnaG_DnaB_bind NAD_binding_8 SRP_SPB
Motif
Other DBs
NCBI-ProteinID: AMM33458
UniProt: A0A127A1X0
LinkDB All DBs
Position
complement(3019206..3020924)
Genome map
AA seq 572 aa AA seqDB search
MTAQLSPEYREASLSRLRESTQPGRELDILVVGGGVVGAGSALDAATRGLEVGIVEMRDW
ASGTSSRSSKLIHGGLRYLEMLDFRLVQEALQERGLLLQRIAPHLVHPVPFLYPLTRRFW
ERPYVGTGMVLYDTLGLTRHGTGLPIHKHLFRRGTLRAAPSLREDAMIGSVRYYDAQVDD
ARMVAGLVRTAAQYGAHAANRVAVVDFLREGERVVGARMRDHETGSEFEVRAKQVINATG
VWTDETQGMVTDRGQLKVRASKGVHLVVPRDRFQSTVGLILRTEKSVLFVIPWGRHWIIG
TTDTDWKLEKAHPAASSSDIDYILEHVNRVLKRPLTREDVEGVYAGLRPLLAGESESTTK
LSREHVVAHPVPGLVVVAGGKYTTYRVMAKDAVDEATRAMDERIAPSCTDRVPLVGAEGY
RAVWNRRHRLADRSGVHVARVEHLLRRFGSLTEEVLALVKERPELAEPLPGADDYLRAEA
VYATTHEGARHVEDVLTRRTRISIEAWDRGVSAAPVVADLMAPILGWSQTQRDNEVAHYL
ARVEAERLSQQQPDDESAEAARMGAEDIVPVK
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacagctcagcccggagtaccgggaagcctccctctcccggctcagggagtcc
acccagcccggccgcgagctcgacatcctcgtggtcggcggcggagtggtcggcgccggc
tcggcgctcgacgcggcgacgcgcgggctcgaggtcgggatcgtcgagatgcgggactgg
gcctccgggacctcctcccgctcgtcgaagctcatccacggcggtctgcggtacctcgag
atgctggacttccgcctggtccaggaggccctgcaggagcggggcctcctgctccagcgg
atcgcaccccacctcgtgcatccggtgccgttcctgtacccgctcacccggcgcttctgg
gagcggccctacgtgggcacgggcatggtcctctacgacacgctggggctcacccgccac
ggcaccgggctgcccatccacaagcacctgttccggcgcggcacgctccgggccgcgccg
agcctgcgcgaggacgccatgatcggctccgtccgctactacgacgcgcaggtcgacgac
gcccgcatggtcgccgggctcgtgcggaccgcggcgcagtacggcgcgcacgcggccaac
cgggtggcggtcgtggacttcctgcgcgagggcgagcgcgtggtcggggcgcggatgcgg
gaccacgagaccggctcggaattcgaggtgcgggccaagcaggtcatcaacgccaccggg
gtatggacggacgagacccaggggatggtcaccgaccggggtcagctcaaggtgcgcgcc
tccaagggcgtccatctcgtggtgccccgggaccggttccagtccacggtcgggctcatc
ctgcgcaccgagaagtcggtcctgttcgtcatcccgtgggggcggcactggatcatcggc
accacggacaccgactggaagctcgagaaggcccatccggccgcgtccagcagcgacatc
gactacatcctcgagcacgtcaaccgggtcctgaagcggcccctgacgagggaggacgtc
gagggcgtctacgccgggctcaggccgctgctggccggtgagagcgagtccacgaccaag
ctcagccgggaacacgtcgtcgcccatcctgtcccgggcctcgtggtcgtggcgggcggg
aagtacacgacgtaccgggtcatggccaaggacgcggtggacgaggcaacccgcgccatg
gacgagcgcatcgctccctcctgcaccgacagggtcccgctcgtgggggccgaggggtac
cgggcagtctggaaccggcggcaccgcctggccgacaggtctggcgtccacgtggcccgg
gtcgagcacctcctgcgccgcttcggctcgctcacggaggaggtcctcgcgctcgtcaag
gagcggcccgagctcgcagagccgctgccgggcgccgacgactacctccgtgcggaggcc
gtgtacgccaccacccacgagggcgcccggcacgtcgaggacgtcctgacccgccgcacc
cgcatctccatcgaggcgtgggaccgcggcgtgtccgcggcgcccgtcgtcgcggacctc
atggccccgatcctcggctggagccagacccagcgcgacaacgaggtggcgcactacctc
gcccgcgtcgaggccgagcggctgagccagcagcagccggacgacgagtccgcggaggcc
gcgcggatgggtgccgaagacatcgtcccggtaaagtaa

DBGET integrated database retrieval system