KEGG   Sinomonas atrocyanea: SA2016_2912Help
Entry
SA2016_2912       CDS       T04286                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
satk  Sinomonas atrocyanea
Pathway
satk00010  Glycolysis / Gluconeogenesis
satk00030  Pentose phosphate pathway
satk00051  Fructose and mannose metabolism
satk00052  Galactose metabolism
satk00680  Methane metabolism
satk01100  Metabolic pathways
satk01110  Biosynthesis of secondary metabolites
satk01120  Microbial metabolism in diverse environments
satk01130  Biosynthesis of antibiotics
satk01200  Carbon metabolism
satk01230  Biosynthesis of amino acids
Module
satk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
satk_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:satk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA2016_2912
   00030 Pentose phosphate pathway
    SA2016_2912
   00051 Fructose and mannose metabolism
    SA2016_2912
   00052 Galactose metabolism
    SA2016_2912
  09102 Energy metabolism
   00680 Methane metabolism
    SA2016_2912
Enzymes [BR:satk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SA2016_2912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AMM33577
UniProt: A0A127A313
LinkDB All DBs
Position
complement(3146696..3147658)
Genome map
AA seq 320 aa AA seqDB search
MAMEGAQPSGARQILTLTVNPALDISTATAKVESSHKLRCGASRVDPGGGGVNVARVIQR
LGGRSVALFTAGGPTGEAYRRLVEAERVPSLVVPIRGSTRQNFTVDETSSGRQYRFVLEG
PELSEAEWVSCLDLVAHTVPRGGYVVASGSLPPGVPDDFYARVARLARENGARCLVDASG
SALGRALSEGVFLVKPSLRELAEHAGGALESEQDQMDAAAALVSGGSAEYVALTLGARGA
ALASSSGVLRLRVPSVPVVSTVGAGDSFMAAFVLRMAQGRPAGEAFRAAVAAGSAAVMTP
ATELCHRADVERLEAELRSA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtggccatggaaggggcacagccctccggggcgaggcagatcctgacgctgacggtcaac
ccggccctggacatcagcaccgcgacggcgaaggtggagagcagccacaagctccggtgc
ggtgccagccgggtggacccgggcgggggcggcgtgaacgtggcccgggtgatccagcgg
ctcggagggcgcagcgtggccctgttcaccgcgggcggccccaccggggaggcctaccgc
cgtctcgtcgaggccgagcgcgtccccagcctcgtggtgcccatccggggcagcacgcgc
cagaacttcaccgtggacgagacctcgagcggccggcagtaccggttcgtgctggagggc
cctgaactcagcgaggccgagtgggtcagctgcctcgatctcgtggcgcacacggtccca
cggggcgggtacgtggtggccagcgggagcctgccgccgggggtgccggacgacttctat
gcccgggtggcccgcctcgcgcgggagaacggtgcgcgctgcctcgtcgacgcctccggc
tccgccctcggcagggccctcagtgagggcgtgttcctggtcaagcccagcctgcgcgag
ctcgcggagcacgcgggcggggccctcgagagcgaacaggaccagatggacgcggccgcc
gcgctggtctccggagggtcagccgagtacgtcgccctcaccctgggcgcgcggggcgcc
gccctggcgtcgagctccggcgtcctgcgcctgcgggtccccagcgtgccggtggtcagc
accgtcggcgccggggacagcttcatggcagcattcgtcctgcggatggcgcagggacgc
cccgccggggaggccttcagggccgccgtggctgccgggagcgcggccgtgatgaccccg
gccaccgagctgtgccaccgcgcagacgtggaacgcctcgaggccgagctgcgctcggcg
tga

DBGET integrated database retrieval system