KEGG   Sinomonas atrocyanea: SA2016_3180Help
Entry
SA2016_3180       CDS       T04286                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
satk  Sinomonas atrocyanea
Pathway
satk00250  Alanine, aspartate and glutamate metabolism
satk00410  beta-Alanine metabolism
satk00430  Taurine and hypotaurine metabolism
satk00650  Butanoate metabolism
satk01100  Metabolic pathways
satk01110  Biosynthesis of secondary metabolites
satk01120  Microbial metabolism in diverse environments
satk02024  Quorum sensing
Module
satk_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:satk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SA2016_3180
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SA2016_3180
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SA2016_3180
   00430 Taurine and hypotaurine metabolism
    SA2016_3180
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SA2016_3180
Enzymes [BR:satk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SA2016_3180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AMM33844
UniProt: A0A127A4Z2
LinkDB All DBs
Position
complement(3431447..3432880)
Genome map
AA seq 477 aa AA seqDB search
MPASRSTFHPASDGWGRRGRREPASNVELNPLFSRPGEATEFPRFTLPAGESLPGTAYQV
VHDDAMLDGNARLNLATFVGTWMEPEAARLYAETVDKNMIDKDEYPKTAEIEHRCWRMLA
DLWNAPEPEHAVGTSTIGSSEACMLAGLALKRRWQHARRAAGKPAARPNLVMSSAVQVCW
EKFCNYWDVEARYVPISHEHPVLDGHGLSEYVDENTIGVVAIMGVTYTGMYEPVAEISQA
LDEVQAATGLDVPIHVDGASGAMVAPFLAPELEWDFRLPRVASINTSGHKYGLVYPGLGW
VVWRDAAALPEDLVFHVSYLGGDMPTFALNFSRPGAQVLLQYYLFLRLGFEGYRAVHAAS
RDVAGYLAREIGAMDPFELWNDGSDIPVFAWSLAPEHTQNWNLHHLSDRLRMNGWLVPAY
PMPDGLADLTVQRIVVRNGFTRDLAESFLEDLRTAVAFLDSADTPFPDPEHGSAFHH
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgcctcccgttccaccttccatcccgcctccgacgggtggggacggcgagggcgc
cgggagcccgcctcgaacgtcgagctgaacccgctcttcagccggcccggcgaggccacc
gaattcccgcgcttcacactgcccgcgggggagagcctgcccggcacggcctaccaggtg
gtccacgacgacgcgatgctcgacggcaacgcccgcctcaacctcgcgaccttcgtgggc
acgtggatggagcccgaggccgcccggctctacgccgagaccgtcgacaagaacatgatc
gacaaggacgagtaccccaagacggccgagatcgagcaccgctgctggcgcatgctcgcg
gacctgtggaacgcgcccgagcccgagcacgccgtcggcacctcgacgatcggctcctcc
gaggcgtgcatgctggccgggctcgcgctcaagcgccggtggcagcacgcccgccgcgcc
gcggggaagccagccgcgcggcccaatctcgtgatgagctcggcggtgcaggtgtgctgg
gagaagttctgcaactactgggacgtcgaggcccgctacgtgcccatctcgcacgagcac
cccgtcctcgacgggcacgggctctcggagtacgtggacgagaacacgatcggcgtcgtg
gccatcatgggcgtcacctataccgggatgtacgagccggtcgccgagatctcccaggcg
ctggacgaggtacaggccgccacgggcctcgatgtgccgatccatgtggacggggcctcg
ggggcgatggtcgccccgttcctcgcccccgagctcgagtgggacttccggctgccccgg
gtcgcctcgatcaacacgtccgggcacaagtacgggctcgtgtaccccggcctcgggtgg
gtggtgtggcgggacgccgccgccctgcccgaggacctcgtgttccacgtgagctacctc
ggcggggacatgcccacgttcgcgctcaacttctcccgccccggcgcgcaggtgctcctg
cagtactacctgttcctccggctggggttcgaggggtaccgggccgtgcacgctgcgtcc
cgggacgtcgcggggtacctggcccgggagatcggggccatggacccgttcgagctgtgg
aacgacggctccgacatcccggtcttcgcctggagcctcgcgccggaacacacccagaac
tggaacctgcaccacctctccgaccggctgcggatgaacggctggctcgtgccggcgtat
ccgatgccggacgggctcgccgacctgaccgtgcagcggatcgtggtgcgcaacggcttt
acccgggacctcgcggagagcttcctcgaggacctgcgcaccgcggtggcgttcctcgac
tccgcggacaccccgttcccggacccggagcacgggagcgccttccaccactga

DBGET integrated database retrieval system