KEGG   Sinomonas atrocyanea: SA2016_3491Help
Entry
SA2016_3491       CDS       T04286                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
satk  Sinomonas atrocyanea
Pathway
satk03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:satk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SA2016_3491
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:satk03400]
    SA2016_3491
Enzymes [BR:satk01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SA2016_3491
DNA repair and recombination proteins [BR:satk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SA2016_3491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AMM34151
UniProt: A0A127A5H1
LinkDB All DBs
Position
3760484..3763138
Genome map
AA seq 884 aa AA seqDB search
MAAQRETVEIEGRRISLSNLDKIMYPESGTTKGDVIEYYRMVGPVMIPAIRDRPATRKRW
VHGVGTADDPGELFFQKNLDERSTPEWVQRVTLHHRRSTNTYPLVNDLPTLVWLAQIAAL
EIHVPQWRAVEEDTMINPDRLVIDLDPGPGAGLPECVEVAHLVKPIFDDMGLLSVPVTSG
SKGIHLYAKLDGSQEWEAVSAVARELAKSLEADHPDLVVADQKKTLRHGRVLVDWSQNSG
QKTTIAPYSLRGRVQPMVAAPRTWEEIGSPGLAHVRYTEMAERLETFGDLFAPLHPPALA
GTHDSSRSSRPRARAAAGARSGSSSGSRSSGEDDDGGARAPSSAASAGGTAAAGADPLTV
YRAKRDAAKTPEPVPAEAPTPGAGDAFVIHEHHARRLHWDLRLEHEGVLASFAIPKGIPT
STGKNHLAVHTEDHPLEYLTFSGSIPQGEYGAGDMSVWDTGTYEAEKWREDEIIVILHGR
EGGGLESVAEGLAGGGNPPGGGVRLALIRTEKGSAGKENWLAHLMKDQAKGHWRRGPHAG
AGAPDAEVGAPATSGPPATSGPPATSGAPASPMLAQSGTAGLVRHGDWMFEMKWDGIRAI
VDTRAGSARLISRNGIDQTLTYPELADLAELGAAVLDGEIIAQSPTGRPDFGLLQQRMNL
SRPTDVERARRAVPVQIVLFDLLEYEGRDLTGLPFRERRAALELLAEGGLPASAQLSPVF
DGSIDDVLEASAEHGLEGVIAKRPSARYEAGRRSGAWVKIKHEKTQEVVVAGWREGKGGR
AGTVGSLLLGIPDDDGVLRYAGRVGSGFTDRMLAEVSSRLRPLERKTPPLDGVPREDTRD
AHWVTPKLVAEVRYGELTSGGRLRHPVWRGWRPDKAAADVVLEG
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgcagcgcgagaccgtcgagatcgagggccgcaggatcagcctgtccaacctg
gacaagatcatgtaccccgagtccgggaccaccaagggcgatgtcatcgagtactacagg
atggtcggccccgtcatgatcccggccatccgggacaggcccgcgacccggaagcggtgg
gtgcacggcgtgggcaccgcggacgatccgggggagctgttcttccagaagaacctcgac
gagcgatccactcccgagtgggtccagcgggtcacgctccaccaccgccgctcgaccaac
acctatcccctggtcaacgacctgcccaccctcgtctggctcgcccagatcgccgccctc
gagatccacgtgccgcagtggcgcgcggtcgaggaggacaccatgatcaacccggaccgg
ctcgtgatcgacctcgatccgggcccgggcgcggggctgcccgagtgcgtcgaggtcgcg
cacctggtcaagccgatcttcgacgacatgggcctgctgtccgtcccggtcacgagcggg
tccaagggcatccacctctacgcgaagctcgacggcagccaggagtgggaggccgtctcc
gccgtggcccgcgagctcgcgaagtccctcgaggcggaccacccggacctcgtggtcgcc
gaccagaagaagacgctccggcacggccgcgtgctcgtggactggagccagaacagcggg
cagaagaccacgatcgccccgtactcgctgcgcggccgcgtccagccgatggtcgccgcc
ccgcggacctgggaggagatcggctcccccggcctggcgcacgtgcgctacaccgagatg
gcggagcgcctcgagacgttcggggacctgttcgcgccgctgcacccgcccgcgctggcc
gggacgcacgattccagccgctcgtcccgcccgcgggcccgcgccgccgccggtgcccgc
tcgggttcctccagcggttcccgctcctccggcgaggacgacgacggcggcgcccgcgcg
ccgtcgtccgccgcatccgccgggggcaccgccgcggccggagccgacccgctcacggtg
taccgggccaagcgggacgccgccaagactccggaaccggtcccagccgaggcgcccacg
cccggcgccggcgacgccttcgtgatccacgagcaccacgcgcgccggctgcactgggac
ctgcggctcgagcacgagggggtgctggcctcgttcgccatccccaagggcattccgacc
agcaccgggaagaaccacctcgccgtgcacaccgaggaccatccgctcgagtacctcacc
ttctccggcagcatcccgcagggcgagtacggggccggcgacatgtccgtctgggacacc
ggcacctatgaggccgagaagtggcgcgaggacgagatcatcgtgatcctgcacggacgc
gagggcggcgggctcgagtccgttgccgaggggctggccggcggcgggaatccgccgggc
gggggcgtccggctcgcgctcatccgcacggagaaggggtccgccgggaaggagaactgg
ctcgcgcacctcatgaaggaccaggccaaggggcactggcggcgcggcccccacgccggg
gccggggcgcccgacgccgaggtcggggcgcccgcgacgtctgggccacccgcgacgtcc
gggccacccgcgacgtccggggcgcccgcctccccgatgctcgcccagtccggcacggcg
ggcctggtgcggcacggcgactggatgttcgagatgaagtgggacggcatccgcgcgatc
gtggacacccgggccggctcggcccggctgatcagccgcaacgggatcgaccagaccctc
acctatcccgagctcgccgacctcgccgagctcggggccgccgtgctcgacggcgagatc
atcgcccagagcccgaccggccgccccgacttcgggctcctgcagcagcgcatgaacctc
agccggccgaccgacgtcgagagggcccggcgggcggtgcccgtgcagatcgtgctgttc
gacctgctcgagtacgaggggcgcgacctcaccgggctgccgttccgcgagcgccgggcg
gccctcgagctcctcgccgagggcggcctgcccgcgagcgcgcagctctcccccgtcttc
gacggcagcatcgacgacgtcctggaggcctccgccgagcacggcctcgagggcgtcatc
gccaagcgtccctcagcccgctacgaggccggccgccgctcgggcgcgtgggtgaagatc
aagcacgagaagacccaggaggtcgtggtggccggctggcgcgaggggaagggcggccgg
gcggggacggtcggctccctcctgctcggcatcccggacgacgacggcgtgctgcggtac
gcgggccgggtcggctcgggcttcacggaccgcatgctcgccgaggtctcgtcccggctg
cgccccctcgagcgcaagaccccgcccctcgacggcgtgccccgggaggacacgcgggac
gcccactgggtcacgccgaagctcgtcgcggaggtccggtacggggagctcacgagcggc
ggacgactccgtcaccccgtctggcggggctggcggccggacaaggccgcggcggacgtg
gtgctggagggctga

DBGET integrated database retrieval system