KEGG   Sinomonas atrocyanea: SA2016_4102Help
Entry
SA2016_4102       CDS       T04286                                 

Definition
(GenBank) DNA ligase
Organism
satk  Sinomonas atrocyanea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase PNKP_ligase DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AMM34754
UniProt: A0A127A7K0
LinkDB All DBs
Position
pSA01:12636..13634
Genome map
AA seq 332 aa AA seqDB search
MPSPWSRTLGGPFELALAKAVPAVPTRAETLYESKFDGFRVALVVEDDGVMLFSRNGTDL
TARFPELAAAAAEQVPPDGCVLDGEAVIWGHDRLDFDALQRRMGAGPATARRLAAEQPAS
FVAFDVLAVLGRDVRAMPLSDRRRLLEELAAGFSPPLELSHATTDRAEAMRWWDELARTG
IEGLMAKSLSQPYRGAERAWSKIKRRDDTDSLCGAVIGPRSRPRQLVLGAWDTDGRLRFT
GRTALLTAVQASAAAEFLKPPAGGHPWPEEVPATAFDRFARDRGPVRLTLVEPVVVEVSA
DSARSGVAFRHSVRLARFRPDLDPTAVRIEIG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgccatcgccgtggtcccggacgctgggcggcccgttcgagctcgccctggccaaggcc
gtcccggccgtccccacccgtgcggagaccctgtacgagtcgaagttcgatgggttccgc
gtcgccctcgtcgtcgaggatgacggggtcatgctcttttcgcgcaacggcactgacctg
acagcgcgcttccctgagctcgcggcggccgcagccgagcaggtccccccggacgggtgc
gtgctcgacggcgaggccgtcatctggggccatgaccggctggacttcgacgccctccag
cgccgcatgggagccggccccgccaccgcgcgtcgtctggccgccgagcagccggcctcg
tttgtggccttcgacgtgctcgcggtgctcgggcgggatgtgcgggctatgccgctgtcc
gaccggcggcggctgctcgaggaactcgccgcagggttctcgccgccgctggagctctcg
cacgcgacgaccgacagggccgaggccatgcgctggtgggacgagctcgcccgcaccggc
atcgagggcctgatggcgaagtcgctcagccagccctaccggggtgcggagagggcgtgg
tcgaagatcaagagacgagacgacaccgattccctctgcggcgcggtaattgggccgagg
tcccggccgcgtcagctcgtcctcggcgcctgggacaccgacggccggctgcggttcacg
ggccgcaccgcgctcctcacggcagtgcaggcgtcggctgcggccgagttcctcaaaccc
ccggccggcgggcacccctggccggaggaagtgccggccacagcctttgaccgcttcgcc
cgcgaccgcggtcccgtgcgcctgacgctcgtggagccggtcgtcgtggaggtttcggcg
gactccgccaggtccggtgtcgccttcaggcattcggtccgcctcgcgcgttttcgcccc
gacctcgacccgacggcggtcaggatcgagatcggttag

DBGET integrated database retrieval system