KEGG   Spiroplasma atrichopogonis: SATRI_v1c10280Help
Entry
SATRI_v1c10280    CDS       T03973                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
satr  Spiroplasma atrichopogonis
Brite
KEGG Orthology (KO) [BR:satr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:satr01001]
    SATRI_v1c10280
Enzymes [BR:satr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SATRI_v1c10280
Protein kinases [BR:satr01001]
 Serine/threonine kinases: Other
  Bacterial family
   SATRI_v1c10280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-ProteinID: AKM53394
LinkDB All DBs
Position
complement(924653..925663)
Genome map
AA seq 336 aa AA seqDB search
MEQITSGTILHNRYEIIGKIADGGMAEVFEAYDNILKRNVAIKIMSVSLSKNKEAVYRFN
KEYNSIAQFSHNNVVKVYGTFEVYDRQCIVLELVKGYTLKNRLLTLGPCTLHELIYFFQD
INLAIIEAHRNDIIHRDIKPENILISYDGKIKVADFGVAILDNNSEDLENNKIIGTSKYM
APEIVQSKPATKKSDIYALGIMLYELTIGMAPFVGKSPTLVAVKHVKELPLPPRLIDPHL
PQSLQNVILKAIAKDPNERYQTVEQFNQDLTAILTPTHQADKPLHFRNVIEIKGKRVKVR
DRYLAIPKVLNTNLIITFAIFGLLLLIIGLLLSFLL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaattacaagtggaacaattttacataatcgttatgaaattattggcaagatt
gcggatgggggaatggccgaagtttttgaagcttatgataatattttaaaacgcaacgtg
gcaattaaaataatgtcggttagtttgtctaaaaataaagaagctgtttaccgctttaac
aaagaatataattcaattgcccaattttcacataataatgttgtgaaggtttatggaaca
tttgaagtttatgatcgccagtgtattgttttagaactagttaagggttacactttaaaa
aaccgcttattaaccttagggccttgtactttacatgaactaatttatttttttcaggat
atcaatttagcaattattgaagcccaccgcaatgatattattcatcgtgatattaaacca
gaaaatatcttaatttcttatgatgggaagattaaagttgctgattttggagttgccatc
ttagacaataatagtgaagatttagaaaataataaaattattggaacctcaaaatatatg
gcgccggaaattgttcagtccaaaccagctaccaaaaaaagtgatatttatgcgctagga
attatgctatatgaactaacgattggaatggctccgtttgtgggaaaaagtccgacttta
gtagcagttaaacatgttaaagaactgcccttaccaccacgattaattgatccgcatctg
ccccaaagcttacaaaatgttattttaaaagcaattgccaaagatcctaatgaacgctac
caaacagttgagcagtttaatcaagatttaacagcgattcttaccccaacccatcaagca
gataaaccattacattttcggaatgtcattgaaattaaaggaaagcgggttaaagttcgc
gaccgttatctagctattccaaaagttttaaataccaatctaattattacttttgcgatt
tttggtttattattactaattattgggttattactatcatttcttttataa

DBGET integrated database retrieval system