KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0239Help
Entry
SA0239            CDS       T00051                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00040  Pentose and glucuronate interconversions
sau00051  Fructose and mannose metabolism
sau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SA0239
   00051 Fructose and mannose metabolism
    SA0239
Enzymes [BR:sau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SA0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AdoHcyase_NAD NAD_binding_3 ADH_N_2 UDPG_MGDP_dh_N TrkA_N adh_short_C2 2-Hacid_dh_C CHASE4
Motif
Other DBs
NCBI-ProteinID: BAB41462
NITE: SA0239
UniProt: A0A0H3JSN8
LinkDB All DBs
Position
290120..291175
Genome map
AA seq 351 aa AA seqDB search
MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVTLGH
EFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCKSKDYNLCNHRKGIGTQVDGVFT
NYVIAREESLHHIPDEVSYQSAAMTEPLACAHHGVSKIQVNSGDVAVVMGPGPIGLLVAQ
VLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVVECS
GAVPAARQGLDIIRKKGFYSQIGIFKDAEIPFDMEKVIQKEITVVGSRSQKPADWEPSLQ
LMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKALLKPLDLDENEGEN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctttagtaaaaacaagagaaggacatggcaacttagaacttcttgataaagaa
gttgcaacaccgctagatgataaagtaaagattaaagtacattatgcaggaatttgtggc
acagacattcatacttatgaagggcattataaagttaattttccagtgacattaggtcat
gaattttctggtgaaatcgttgaagttggagcagacgttaaagattttaaagttggtgac
cgtgtcacttctgaaactacattctatgtttgtaatgagtgtgaatactgtaaatcaaaa
gactataatttatgcaaccatcgaaaaggtattggaacacaagttgatggcgtatttact
aattatgtcattgcacgtgaagaaagtttgcatcatattccagacgaagtatcgtatcag
tctgcagctatgacagaaccattagcatgtgcacatcatggcgtttctaagattcaagtg
aactctggcgatgtagcagttgtaatgggacctgggccaatcggattacttgtagcacaa
gtgttgaaaagtaaaggcgcaactgttgtggtaactggattggacaatgacaaagtcaga
ttagataaagcagaagcattgcacatggattatgtagtcaatttacaacaaacagactta
aaaacgtatatcaatggaattacagacggttacggtgcagatgttgttgttgaatgttca
ggtgcagttccagcagcacgacaaggtttagatattatacgcaaaaaaggtttctacagt
caaataggtatttttaaggatgctgaaattccatttgatatggaaaaagtgattcaaaaa
gaaataacagttgttggtagtagaagtcaaaagccagcagattgggaaccttcattgcaa
cttatggcggatggtttagtaaatgctgaagctttggtgacaaaaatatatgatatttcg
aaatgggacgaggcgtatcaacatttaaaatctggcgaaggtattaaagcattacttaag
ccgctcgatttagatgaaaatgaaggagagaattaa

DBGET integrated database retrieval system