KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0240Help
Entry
SA0240            CDS       T00051                                 

Definition
(GenBank) ORFID:SA0240; sorbitol dehydrogenase homologue
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00040  Pentose and glucuronate interconversions
sau00051  Fructose and mannose metabolism
sau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SA0240
   00051 Fructose and mannose metabolism
    SA0240
Enzymes [BR:sau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SA0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 PrmA Methyltransf_25 2-Hacid_dh_C Methyltransf_31 UDPG_MGDP_dh_N DUF4179
Motif
Other DBs
NCBI-ProteinID: BAB41464
NITE: SA0240
UniProt: A0A0H3JJL9
LinkDB All DBs
Position
291347..292390
Genome map
AA seq 347 aa AA seqDB search
MKALKLYGVEDLRYEDNEKPVIESANDVIVKVRATGICGSDTSRYKKMGPYIKGMPFGHE
FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDLAIESSGAKV
TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcattgaaattatatggcgtagaagatttacggtatgaggataatgaaaagcca
gtcattgaaagtgcgaatgacgttattgttaaagtacgagcgactggcatatgtggttca
gacacgtcacgatacaaaaaaatggggccatacattaaaggtatgccatttggtcatgaa
ttttcaggtgtagtagatgccattggaagtgatgttacgcatgttaatgtgggcgacaaa
gtgacaggttgcccagcaataccttgttatcaatgcgagtattgtttgaaaggtgaatat
gcacgatgtgaaaagttattcgtcattggctcatatgaacctggatcgttcgcggaatat
gtcaaattgccagcgcaaaatgttttaaaggttccagacaatgttgattacattgaagca
gcaatggttgagccatcagccgttgttgcgcatgggttttataaatcgaatatacaacct
ggtatgactgttgcagtaatggggtgtggcagtataggtttgttagctattcaatgggca
cgaatatttggtgctgcacatatcatcgctatagatatagatgcgcataaactagatatt
gcaacatcattgggcgcacatcaaacaatcaattcaaaagaagaaaatcttgagaaattc
atcgaaaatcattacgccaatcaaatcgatttagctatagaatcatcaggtgctaaagtt
acgattggtcaaatattgacgctacctaaaaaaggtggcgaggtggtattactcggaata
ccatatgatgatattgagattgatcgcgttcattttgaaaaaattctgcgtaacgagttg
acagtatgtggctcttggaactgtttgtccagtaattttccgggcaaagagtggacggca
accttacattatatgaagacgaaagatattaatgtaaagcctattatttctcatttttta
ccgttagaaaaaggcccggagacatttgataaattagttaacaagaaagaacgatttgat
aaagtcatgtttacgatttattag

DBGET integrated database retrieval system