KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA1520Help
Entry
SA1520            CDS       T00051                                 

Gene name
pykA
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00010  Glycolysis / Gluconeogenesis
sau00230  Purine metabolism
sau00620  Pyruvate metabolism
sau01100  Metabolic pathways
sau01110  Biosynthesis of secondary metabolites
sau01120  Microbial metabolism in diverse environments
sau01130  Biosynthesis of antibiotics
sau01200  Carbon metabolism
sau01230  Biosynthesis of amino acids
Module
sau_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sau_M00002  Glycolysis, core module involving three-carbon compounds
sau_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sau_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA1520 (pykA)
   00620 Pyruvate metabolism
    SA1520 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    SA1520 (pykA)
Enzymes [BR:sau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     SA1520 (pykA)
Membrane trafficking [BR:sau04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SA1520 (pykA)
Exosome [BR:sau04147]
 Exosomal proteins
  Proteins found in most exosomes
   SA1520 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C PEP-utilizers IF2_N HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: BAB42787
NITE: SA1520
UniProt: Q7A559
LinkDB All DBs
Structure
PDB: 

Position
complement(1734257..1736014)
Genome map
AA seq 585 aa AA seqDB search
MRKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRLDKI
VAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSY
ILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKKGVNLPGVRVSLPGITEKDAEDIRF
GIKENVDFIAASFVRRPSDVLEIREILEEQKANISVFPKIENQEGIDNIAEILEVSDGLM
VARGDMGVEIPPEKVPMVQKDLIRQCNKLGKPVITATQMLDSMQRNPRATRAEASDVANA
IYDGTDAVMLSGETAAGLYPEEAVKTMRNIAVSAEAAQDYKKLLSDRTKLVETSLVNAIG
ISVAHTALNLNVKAIVAATESGSTARTISKYRPHSDIIAVTPSEETARQCSIVWGVQPVV
KKGRKSTDALLNNAVATAVETGRVSNGDLIIITAGVPTGETGTTNMMKIHLVGDEIANGQ
GIGRGSVVGTTLVAETVKDLEGKDLSDKVIVTNSIDETFVPYVEKALGLITEENGITSPS
AIVGLEKGIPTVVGVEKAVKNISNNMLVTIDAAQGKIFEGYANVL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaactaaaattgtatgtacaattggaccagcttcagaatcagaagaaatgatt
gagaaattaatcaatgctggtatgaacgttgcacgattaaacttttcacatggtagtcat
gaagagcataaaggtagaattgatacaattcgtaaagtagctaaaagattagacaaaatt
gtagcaattttattagatacgaaaggtccagaaattcgtacgcataatatgaaagacggt
atcattgaacttgaacgtggtaacgaagttattgttagcatgaatgaagttgaaggaaca
cctgaaaagttctcagtaacatatgaaaacttaattaacgatgttcaagtaggttcatac
attttacttgatgatggcttaattgaattacaagttaaagatattgaccatgctaaaaaa
gaagttaaatgtgatattttaaactctggtgagcttaaaaacaaaaaaggtgttaactta
cctggtgtaagagtaagtttacctggtattacagaaaaagatgctgaagatatccgtttc
ggtattaaagaaaatgttgacttcattgcagcaagtttcgtacgtcgtcctagtgatgtt
ttagaaattcgtgaaattttagaagaacaaaaagctaacatttcagtattccctaaaatt
gaaaaccaagaaggtattgataatattgcggaaattcttgaagtgtctgatggtttaatg
gttgcacgtggtgacatgggtgttgaaattccacctgaaaaagtaccaatggttcaaaaa
gatttaatcagacaatgtaacaaattaggtaaaccagttattacagctacacaaatgtta
gattctatgcaacgtaacccacgtgctacacgtgcagaagctagtgacgttgccaacgca
atctatgatggtacagatgcagtaatgttatctggtgaaactgctgctggtttatatcct
gaagaagctgttaaaacaatgagaaatattgctgtatcagctgaagcagcccaagattat
aaaaagttattgtcagatcgtactaaattagttgaaacttcattagtgaatgctatcggt
atttcggttgcacatacagctttaaacttaaatgttaaagcaattgtagctgctactgaa
agtggttcaacggcacgtactatctctaaatatcgtccacattcagacattattgcggtg
actccaagtgaagaaacagcacgtcaatgttcaattgtttggggagttcaacctgtagtt
aaaaaaggacgtaagagtacagatgcattgttaaacaatgcagttgcaacagctgttgaa
actggtagagtatctaatggtgatttaatcattattactgctggtgtaccaactggtgaa
actggaactactaatatgatgaaaatccacctagttggtgacgaaattgctaatggtcaa
ggtattggacgtggatcagttgttggtactacgttagttgctgaaactgttaaagattta
gaaggtaaagatttatctgacaaagttatcgttactaactcaatcgatgaaacgtttgta
ccttatgtagaaaaagctttaggattaattacagaagaaaatggtattacatcaccaagt
gcaattgttggtttagaaaaaggtattccaacagttgtaggtgtagaaaaagctgttaaa
aacataagcaataacatgttagttacgattgatgctgctcaaggtaaaatctttgaagga
tatgcaaacgtactataa

DBGET integrated database retrieval system