KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA1536Help
Entry
SA1536            CDS       T00051                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07090  uncharacterized protein
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Brite
KEGG Orthology (KO) [BR:sau00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SA1536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: BAB42803
NITE: SA1536
UniProt: A0A0H3JQF0
LinkDB All DBs
Position
complement(1754832..1755602)
Genome map
AA seq 256 aa AA seqDB search
MDLNLTMIIIIILFGFIAAFIDSVVGGGGLISTPALLAIGLPPSVALGTNKLASSFGSLT
SMIKFIRSGKVDLFVVAKLFGFVFLASACGAYIATMVPSQILKPLIIIALSSVFIFTLLK
KDWGNTRTFTQFTFKKAIIFAALFILIGFYDGFVGGGTGSFMLFVLLVFGFDFLSAAGNA
KVLNFASNIGALVLFMVLGQVDYVIGLIMAISMIAGSYTGAHFAIKQGVGYVKVLFIIIT
AILILKNAFDYIQQFV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggatttgaacttaacgatgattataatcataattttatttggttttatcgcggcgttt
atagattcggttgtagggggtggcggtttaatttctacgccagcattattagcaatcggt
ctaccaccatctgtggctttaggtacaaataaattggcaagttcatttggttctttaact
agtatgataaagtttataaggtccggtaaagtggacttatttgttgttgccaaattattt
ggttttgtatttttggcatctgcatgtggcgcatatattgcaacgatggttccgtcacaa
atattgaaacctctaatcattattgcactttcgtcggtgtttatattcacattacttaaa
aaagattggggcaatacacgcacgtttactcaatttacatttaagaaagccataatattt
gcagcactttttatattaatcggcttttatgatggatttgtaggtgggggaacaggttca
tttatgctttttgtattgttagtctttggttttgattttttaagtgcagcaggaaatgct
aaagttttgaactttgcttctaatataggtgcgcttgtattatttatggtattaggacaa
gtagattatgtaataggtttaattatggctataagtatgattgctgggtcatatactgga
gcacattttgctatcaaacaaggtgttggctatgtaaaagtattatttattattattact
gctattttaattttaaaaaatgcttttgattatattcaacaatttgtataa

DBGET integrated database retrieval system