KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA2132Help
Entry
SA2132            CDS       T00051                                 

Definition
(GenBank) ORFID:SA2132; hypothetical protein, similar to ABC transporter (ATP-binding protein)
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Brite
KEGG Orthology (KO) [BR:sau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sau02000]
    SA2132
Transporters [BR:sau02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    SA2132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_13 SbcCD_C AAA_23 WhiA_N
Motif
Other DBs
NCBI-ProteinID: BAB43433
NITE: SA2132
UniProt: A0A0H3JRG9
LinkDB All DBs
Position
complement(2397120..2398019)
Genome map
AA seq 299 aa AA seqDB search
MGLVIEHVTKRFGKMTAVNDISLELESGKMLGFLGRNGAGKTTTFRMILGLSEPTEGHIT
YNGKKLDKTMYNRIGYLPEERGLHGKLTVEEELKYLATLKGMSKTEIQQQISYWLERFDI
TENRKKRIDSLSKGNQQKIQLLASMLHKPELLILDEPFSGLDPVNVELLKEAVKDLNDWG
STIVYSSHRMEHVEELCDDVCILDKGQLVVSGDINHVRASNGNKKVVIESETTLPDLTNI
RGIIHSENMKQGLQLTIENEDVAKDIYQVVAHQGYVKRFQVVEPSLQDIFIEKVGGKDA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgggacttgtaattgaacatgttacgaaacgttttggcaagatgacggcagtaaatgat
atttcattagagttagaatcaggcaaaatgttaggttttctaggaagaaatggtgcaggt
aaaacaacgacatttcgtatgattttaggcttaagtgaaccaactgaaggacacattacg
tataacggtaaaaaactagataaaacaatgtacaatcgtattggttatttaccggaagaa
cgcggtttacatgggaaattgacagttgaagaagaattgaaatatttggcaactttaaag
ggaatgtcaaaaacagaaatacaacagcaaatatcgtattggcttgagcgttttgatatt
actgaaaaccgcaaaaaacgaattgatagtctatcaaaagggaatcaacaaaaaattcag
ctgttagcaagtatgttacataaaccagaattactaatattagatgagcctttcagtggt
ctagacccagttaatgttgagttattaaaagaagcagttaaagacttaaatgattggggc
agtacaatcgtttatagttctcaccgtatggagcatgttgaagaattatgtgatgatgtt
tgtattttagataaaggtcaacttgttgtttctggtgatatcaatcatgtacgtgcatct
aatggtaacaagaaagttgtcattgaatcagaaacaacactaccagatttaacaaacatt
agaggcatcattcatagtgaaaacatgaagcaaggtcttcagttgacgattgagaatgaa
gacgtagccaaagatatttatcaagttgtggcacatcaaggttatgttaaacgattccaa
gttgtagaaccatcattacaagatatattcattgagaaggttggtggcaaggatgcataa

DBGET integrated database retrieval system