KEGG   Staphylococcus aureus subsp. aureus 55/2053: SAAG_02030Help
Entry
SAAG_02030        CDS       T02810                                 

Definition
(GenBank) glucose-specific phosphotransferase enzyme IIA component protein
  KO
K02777  PTS system, sugar-specific IIA component [EC:2.7.1.-]
Organism
saua  Staphylococcus aureus subsp. aureus 55/2053
Pathway
saua00010  Glycolysis / Gluconeogenesis
saua00500  Starch and sucrose metabolism
saua00520  Amino sugar and nucleotide sugar metabolism
saua01100  Metabolic pathways
saua02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:saua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAAG_02030
   00500 Starch and sucrose metabolism
    SAAG_02030
   00520 Amino sugar and nucleotide sugar metabolism
    SAAG_02030
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    SAAG_02030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:saua02000]
    SAAG_02030
Enzymes [BR:saua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     SAAG_02030
Transporters [BR:saua02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    SAAG_02030
   Maltose/glucose-specific II component
    SAAG_02030
   Maltose-specific II component
    SAAG_02030
   Beta-glucoside (arbutin/salicin/cellobiose)-specific II component
    SAAG_02030
   Trehalose-specific II component
    SAAG_02030
   N-Acetylmuramic acid-specific II component
    SAAG_02030
   Alpha-glucoside-specific II component
    SAAG_02030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_1 Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: EEV04081
LinkDB All DBs
Position
complement(1363866..1364366)
Genome map
AA seq 166 aa AA seqDB search
MFKKLFGKGKEVQKDIAIYAPLTGEYVKIEDIPDPVFAQKMMGEGFGINPTEGEVVSPIA
GRVDNVFPTKHAIGLKADNGLELLVHIGLDTVQLDGEGFEVLVSSGDEVNVGDPLVRFNL
EYINNNAKSVISPIIITNTDQAASINIYDENAVIKGETKVIDVTMN
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaattattcggaaaaggcaaagaagttcagaaagatatcgcaatttatgca
ccattaactggagaatacgtgaaaattgaagatattccagatcctgtattcgcacaaaaa
atgatgggcgaagggtttggtattaatccaactgaaggagaagttgtgtctccaattgca
ggacgtgttgacaatgtctttccaactaagcatgcaattggtttaaaagcagataacggc
ttagaattattagttcatatcggtttagacacagttcaattagacggtgaaggatttgaa
gtgttagtgtctagtggtgatgaagttaacgtcggagatccattagtaagattcaacctt
gaatatattaataataatgctaaatctgttatttcaccaattataattactaacactgat
caagcggcttctattaatatttatgatgaaaatgctgtgattaaaggtgaaactaaagtg
attgatgtgacaatgaactaa

DBGET integrated database retrieval system