KEGG   Staphylococcus aureus subsp. aureus 55/2053: SAAG_02075Help
Entry
SAAG_02075        CDS       T02810                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
saua  Staphylococcus aureus subsp. aureus 55/2053
Pathway
saua00400  Phenylalanine, tyrosine and tryptophan biosynthesis
saua01100  Metabolic pathways
saua01110  Biosynthesis of secondary metabolites
saua01130  Biosynthesis of antibiotics
saua01230  Biosynthesis of amino acids
Module
saua_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:saua00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAAG_02075
Enzymes [BR:saua01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     SAAG_02075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: EEV04126
LinkDB All DBs
Structure
PDB: 

Position
complement(1438397..1439461)
Genome map
AA seq 354 aa AA seqDB search
MKLQTTYPSNNYPIFVEHGAIDHISTYIDQFDQSFILIDEHVNQYFADKFNDILSYENVH
KVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFI
QVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFEQILSGYAEVY
KHALLNGESATQDIEQHFKDREILQSLKGMDKYIAKGIETKLDIVVADEKEQGVRKFLNL
GHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDINHYIQYLIQLGYPLDMITD
LDFETLYQYMLSDKKNDKQGVQMVLIRQFGDIVVQHVDQLTLQHACEQLKTYFK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacaaacaacctatccttcaaacaattatccaatatttgttgaacatggtgca
attgaccatattagcacgtatattgatcagtttgatcaaagttttatattaattgacgag
catgtaaatcaatattttgctgataaatttaatgatattttatcatatgaaaatgtgcat
aaagtcattattccagctggtgaaaagacgaaaacatttgagcaatatcaagaaacatta
gaatacattttgtctcatcatgtaacacgtaatacagcgattatagctgttggtggtggt
gcgacaggagattttgcaggatttgtagcagcaacactattaagaggtgtccattttata
caagttcccacaacgattttggcgcatgattctagtgttggcggtaaagtgggtattaac
tcaaagcaaggtaaaaaccttatcggtgcattttatcgtccaactgctgttatttatgat
ttagactttttaaagacgttaccatttgagcaaatattaagtggctatgcagaagtttat
aagcatgcgttattgaatggtgaatcagcgacgcaagatatcgaacagcactttaaagat
agagagatattacagtcattaaaaggtatggataaatatattgctaaaggtattgaaacg
aagctagatattgttgttgcagatgaaaaagaacaaggtgtacgtaaatttttaaattta
ggtcatacatttgggcatgctgttgaatactatcataaaataccacatggtcatgcagtg
atggttggcattatctatcaatttatagttgcgaatgctttatttgattctaagcatgat
attaatcattatattcaatatttaatacaacttggctatcctttagacatgataactgac
ttggattttgaaacgttataccaatatatgctaagtgataaaaagaatgataagcaaggt
gtacaaatggtcttgattagacaatttggagatatcgttgtacaacatgttgatcaacta
acattacaacatgcatgtgaacaattaaaaacatattttaagtag

DBGET integrated database retrieval system