KEGG   Staphylococcus aureus 08BA02176: C248_2136Help
Entry
C248_2136         CDS       T02339                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
saub  Staphylococcus aureus 08BA02176
Pathway
saub00010  Glycolysis / Gluconeogenesis
saub00053  Ascorbate and aldarate metabolism
saub00071  Fatty acid degradation
saub00280  Valine, leucine and isoleucine degradation
saub00310  Lysine degradation
saub00330  Arginine and proline metabolism
saub00340  Histidine metabolism
saub00380  Tryptophan metabolism
saub00410  beta-Alanine metabolism
saub00561  Glycerolipid metabolism
saub00620  Pyruvate metabolism
saub00625  Chloroalkane and chloroalkene degradation
saub01100  Metabolic pathways
saub01110  Biosynthesis of secondary metabolites
saub01120  Microbial metabolism in diverse environments
saub01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C248_2136
   00053 Ascorbate and aldarate metabolism
    C248_2136
   00620 Pyruvate metabolism
    C248_2136
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C248_2136
   00561 Glycerolipid metabolism
    C248_2136
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C248_2136
   00310 Lysine degradation
    C248_2136
   00330 Arginine and proline metabolism
    C248_2136
   00340 Histidine metabolism
    C248_2136
   00380 Tryptophan metabolism
    C248_2136
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C248_2136
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C248_2136
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C248_2136
Enzymes [BR:saub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C248_2136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFR74085
LinkDB All DBs
Structure
PDB: 

Position
complement(2150737..2152164)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADNVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEVAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatatattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacaatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcattattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgagttaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggcttaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggcgttggaaatcctttatctgaacatcctaaagtacgcatgatgtca
tttacaggatcaggccctactggttctaaaattatggaaaaagccgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatacatcgttctagatgacgtagatatt
aaagaagtggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcgggaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagag
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcaattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gacttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggctattttaaataa

DBGET integrated database retrieval system